Clone Name | bart51e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TSJT1_TOBAC (P24805) Stem-specific protein TSJT1 | 53 | 4e-07 |
---|
>TSJT1_TOBAC (P24805) Stem-specific protein TSJT1| Length = 149 Score = 52.8 bits (125), Expect = 4e-07 Identities = 27/97 (27%), Positives = 44/97 (45%) Frame = +2 Query: 140 MLAVFDQTVAKCPEGLRSPPXXXXXXXXXXXXXLMKGFADANDAAVTVXXXXXXXXXXXX 319 MLAVF+Q++ + P L P + + F + Sbjct: 1 MLAVFEQSIGRPPPELSLPQAGIQKKEAKTREEIAESFKTWKQDSTFYHLFNGNFMAFSH 60 Query: 320 XNKNPLVPRMFGSVNDIFCLFPGHVENIGNLKQHYGL 430 N+NPL PR ++D+FC+F G ++N +L++HYGL Sbjct: 61 GNENPLQPRSIVVMDDVFCIFSGALDNTFDLRKHYGL 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,771,970 Number of Sequences: 219361 Number of extensions: 426141 Number of successful extensions: 988 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)