| Clone Name | bart50d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HES3_MOUSE (Q61657) Transcription factor HES-3 (Hairy and enhanc... | 30 | 2.7 | 2 | SPEN_DROME (Q8SX83) Protein split ends | 29 | 4.5 | 3 | HES3_RAT (Q04667) Transcription factor HES-3 (Hairy and enhancer... | 29 | 5.9 | 4 | MT2C_RABIT (P80290) Metallothionein-2C (MT-2C) (Metallothionein-... | 26 | 6.5 | 5 | CLOCK_DROME (O61735) Circadian locomoter output cycles protein k... | 28 | 7.7 |
|---|
>HES3_MOUSE (Q61657) Transcription factor HES-3 (Hairy and enhancer of split 3)| Length = 175 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 403 QIRSYRQSHGIHQFASRKQHEACQMVLAVATRLTLQKKVQEAWQV 269 Q+RS + H HQ RK +A + L+V +LQ +Q W V Sbjct: 15 QLRSLLERHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPV 59
>SPEN_DROME (Q8SX83) Protein split ends| Length = 5560 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = -2 Query: 373 IHQFASRKQHEACQMVLAVATRLTLQKKVQEAWQVVQNQARQKQLQKLHQV 221 I Q S++QH+ Q A L+ Q+ + Q+QA+Q+QLQ++ ++ Sbjct: 3911 IQQHQSQQQHQVQQQNQAQQQHLSQQQHQSQQQLNQQHQAQQQQLQQIQKL 3961
>HES3_RAT (Q04667) Transcription factor HES-3 (Hairy and enhancer of split 3)| Length = 175 Score = 28.9 bits (63), Expect = 5.9 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 403 QIRSYRQSHGIHQFASRKQHEACQMVLAVATRLTLQKKVQEAWQV 269 Q+RS + H HQ RK +A + L+V +LQ +Q W V Sbjct: 15 QLRSLLERHYSHQIRKRKLEKADILELSVKYVRSLQNSLQGLWLV 59
>MT2C_RABIT (P80290) Metallothionein-2C (MT-2C) (Metallothionein-IIC) (MT-IIC)| Length = 62 Score = 26.2 bits (56), Expect(2) = 6.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 240 SCFCLAWFCTTCHASCTFFC 299 SC C A CT+C SC C Sbjct: 19 SCTCKACKCTSCKKSCCSCC 38 Score = 21.6 bits (44), Expect(2) = 6.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 161 STARRTATCGISKTTRPCRC 220 +TA + TC S T + C+C Sbjct: 8 ATAGDSCTCANSCTCKACKC 27
>CLOCK_DROME (O61735) Circadian locomoter output cycles protein kaput (dCLOCK)| (dPAS1) Length = 1027 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = -2 Query: 412 YRHQIRSYRQSHGIHQFASRKQHEACQMVLAVATRLTLQKKVQEAWQVVQNQARQKQLQK 233 ++H ++ QSH Q +++QH+ Q + Q++ Q+ Q Q Q +Q+QLQ Sbjct: 779 HQHNLQQQHQSHSQLQQHTQQQHQQ-QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQL 837 Query: 232 LHQ 224 Q Sbjct: 838 QQQ 840 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,862,317 Number of Sequences: 219361 Number of extensions: 798346 Number of successful extensions: 3094 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3087 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)