Clone Name | bart49b06 |
---|---|
Clone Library Name | barley_pub |
>PMIP_RAT (Q01992) Mitochondrial intermediate peptidase, mitochondrial| precursor (EC 3.4.24.59) (MIP) Length = 710 Score = 32.7 bits (73), Expect = 0.71 Identities = 27/73 (36%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +2 Query: 296 RRRQAVDLSRRLHFVSSVFRSGTSTP----HHLSPSRPLALRACVYKRSARFGRSLVPDL 463 +RR+AVDL+ ++ +SS F GT+ P HL P + AR GR LV D Sbjct: 199 KRRRAVDLNVKILDLSSAFLMGTNFPIKIQKHLLPEH-------IQHHFARDGRHLVID- 250 Query: 464 TSAGAACSDQMVR 502 A SD +VR Sbjct: 251 -GLHAEASDDLVR 262
>MENA_MYCTU (P65650) Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase| (EC 2.5.1.-) (DHNA-octaprenyltransferase) Length = 292 Score = 30.8 bits (68), Expect = 2.7 Identities = 19/39 (48%), Positives = 21/39 (53%) Frame = +2 Query: 395 PLALRACVYKRSARFGRSLVPDLTSAGAACSDQMVRWVL 511 PLALRA RS R GR L+P L G A M+ W L Sbjct: 246 PLALRAAGPVRSGRGGRELIPVLRDTGLA----MLVWAL 280
>MENA_MYCBO (P65651) Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase| (EC 2.5.1.-) (DHNA-octaprenyltransferase) Length = 292 Score = 30.8 bits (68), Expect = 2.7 Identities = 19/39 (48%), Positives = 21/39 (53%) Frame = +2 Query: 395 PLALRACVYKRSARFGRSLVPDLTSAGAACSDQMVRWVL 511 PLALRA RS R GR L+P L G A M+ W L Sbjct: 246 PLALRAAGPVRSGRGGRELIPVLRDTGLA----MLVWAL 280
>STK36_HUMAN (Q9NRP7) Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused| homolog) Length = 1315 Score = 30.0 bits (66), Expect = 4.6 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -3 Query: 184 LQAGVAARRGREGWPREAEGSDAAAARENRCAP---RAGPPHRRRVFSE 47 L AG+ A + W + G +A RENR P RA P R V + Sbjct: 353 LLAGILASELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQ 401
>PK1_STRTO (Q9KIG4) Serine/threonine-protein kinase PK-1 (EC 2.7.11.1)| (stoPK-1) Length = 641 Score = 29.6 bits (65), Expect = 6.0 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 117 LPPLGRTGVRQGP-----GLLIAAGFFPSGRGLWW 28 LPP GRT +R+GP G+L+ G G G+W+ Sbjct: 341 LPPRGRTALRRGPMAIVIGVLLVLGL---GAGVWY 372
>STK36_PONPY (Q5RAJ5) Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused| homolog) Length = 1315 Score = 29.6 bits (65), Expect = 6.0 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = -3 Query: 184 LQAGVAARRGREGWPREAEGSDAAAARENRCAP---RAGPPHRRRVFSE 47 L AG+ A + W G +A RENR P RA P R V + Sbjct: 353 LLAGILASELKSSWAESGTGEAPSAPRENRTTPDCERAFPEERPEVLGQ 401 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,964,032 Number of Sequences: 219361 Number of extensions: 1218710 Number of successful extensions: 5755 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5752 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)