Clone Name | bart49b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VGLB_BHV2B (P12641) Glycoprotein B-1 precursor | 29 | 9.4 |
---|
>VGLB_BHV2B (P12641) Glycoprotein B-1 precursor| Length = 917 Score = 29.3 bits (64), Expect = 9.4 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 6/33 (18%) Frame = -1 Query: 92 GSAHRHGA------LRSPVFSLQGNWAARRPQV 12 G+ RHG+ L +P+F++ NWA +RP V Sbjct: 354 GTGRRHGSPVTYNLLTTPMFTVGWNWAPKRPSV 386 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,095,268 Number of Sequences: 219361 Number of extensions: 557893 Number of successful extensions: 2408 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2407 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)