Clone Name | bart48d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRUD_VIBPA (Q87LQ4) tRNA pseudouridine synthase D (EC 5.4.99.-) ... | 29 | 8.8 |
---|
>TRUD_VIBPA (Q87LQ4) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 347 Score = 29.3 bits (64), Expect = 8.8 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = -3 Query: 576 LRPEVALCDVAVEHVLAAERRLEVRGRLVALEEGVEGREPEALAVEEGQRL 424 ++ ++AL +V + LA + L + +ALE+ EP+ +A+ G R+ Sbjct: 245 MQNKLALSEVEITAALAGDNALPTQADALALEQPFIDEEPDLMALIRGNRM 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,580,633 Number of Sequences: 219361 Number of extensions: 637386 Number of successful extensions: 2598 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2597 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)