Clone Name | bart48c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | WEE1_MOUSE (P47810) Wee1-like protein kinase (EC 2.7.10.2) | 28 | 5.2 | 2 | PCD15_HUMAN (Q96QU1) Protocadherin-15 precursor | 28 | 5.2 | 3 | COL13_CAEEL (P20631) Cuticle collagen 13 precursor | 28 | 6.8 | 4 | COL12_CAEEL (P20630) Cuticle collagen 12 precursor | 28 | 6.8 | 5 | FCERB_MOUSE (P20490) High affinity immunoglobulin epsilon recept... | 27 | 8.9 | 6 | DXS_BRAJA (Q89RW1) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2... | 27 | 8.9 |
---|
>WEE1_MOUSE (P47810) Wee1-like protein kinase (EC 2.7.10.2)| Length = 646 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 147 SYFPDRPACPGQCGAPGQSYTRGC 218 +YF P P +CG PG + +GC Sbjct: 131 AYFLSSPFSPVRCGGPGDASPQGC 154
>PCD15_HUMAN (Q96QU1) Protocadherin-15 precursor| Length = 1955 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -2 Query: 81 PKPPGIACSPPSSA-LLRCLCICM 13 P PP I C PP SA L C+C+ Sbjct: 1820 PPPPSIPCPPPPSASFLSTECVCI 1843
>COL13_CAEEL (P20631) Cuticle collagen 13 precursor| Length = 316 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 156 PDRPACPGQCGAPGQSYTRGCTYQDRCRH 242 P P PGQ GAPGQ G + C H Sbjct: 280 PGAPGAPGQAGAPGQDGESGS--EGACDH 306
>COL12_CAEEL (P20630) Cuticle collagen 12 precursor| Length = 316 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 156 PDRPACPGQCGAPGQSYTRGCTYQDRCRH 242 P P PGQ GAPGQ G + C H Sbjct: 280 PGAPGAPGQAGAPGQDGESGS--EGACDH 306
>FCERB_MOUSE (P20490) High affinity immunoglobulin epsilon receptor beta-subunit| (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-chain) Length = 235 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 324 FTQIIRKEKNHLGCVHQSQRSPTISSISAGTG 229 F II + KN L V S + +SSI+AGTG Sbjct: 105 FLSIISERKNTLYLVRGSLGANIVSSIAAGTG 136
>DXS_BRAJA (Q89RW1) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 661 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 363 RTNTLHAGSGFNHFTQIIRKEKNHLGCVHQSQRSPTISSISAGTG 229 R TL G G + FT+ + + G H S +SISAG G Sbjct: 112 RIRTLRTGGGLSGFTKRSESDYDPFGAAHSS------TSISAGLG 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,859,201 Number of Sequences: 219361 Number of extensions: 813045 Number of successful extensions: 2989 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2976 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)