| Clone Name | bart48a01 |
|---|---|
| Clone Library Name | barley_pub |
>EXG_ASPOR (Q7Z9L3) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 405 Score = 36.2 bits (82), Expect = 0.070 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFD 223 NLGGWLV E WI PS+FD Sbjct: 35 NLGGWLVLEPWITPSIFD 52
>EXG_YARLI (Q12725) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 421 Score = 33.9 bits (76), Expect = 0.35 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGIPNKD 241 NLGGW V E +I PSLF+ N D Sbjct: 41 NLGGWFVLEPFITPSLFEAFGNND 64
>EXG1_SCHPO (Q9URU6) Glucan 1,3-beta-glucosidase 1 precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 407 Score = 33.1 bits (74), Expect = 0.59 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLF 220 N+GGWLV E WI P LF Sbjct: 43 NIGGWLVLENWITPQLF 59
>EXG_BLUGR (Q96V64) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 426 Score = 32.7 bits (73), Expect = 0.77 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGIPN-KDLLD 250 NLGGW V E WI PS+F N D++D Sbjct: 41 NLGGWFVLEPWITPSIFQQWANGGDVID 68
>EXG_SACBA (Q876J3) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 448 Score = 32.7 bits (73), Expect = 0.77 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGIPNKD 241 N+GGWLV E +I PSLF+ D Sbjct: 57 NIGGWLVLEPYITPSLFEAFRTND 80
>EXG2_HANAN (O93983) Glucan 1,3-beta-glucosidase 2 precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase 2) Length = 427 Score = 32.3 bits (72), Expect = 1.0 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGIPNK 238 NLGGW V E +I PSLF+ N+ Sbjct: 46 NLGGWFVLEPFITPSLFEAFENQ 68
>EXG_DEBOC (Q12700) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 425 Score = 32.3 bits (72), Expect = 1.0 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFD--GIPNKD 241 NLGGW V E +I PSLFD PN D Sbjct: 46 NLGGWFVLEPFITPSLFDIYSKPNDD 71
>SPR1_YEAST (P32603) Sporulation-specific glucan 1,3-beta-glucosidase precursor| (EC 3.2.1.58) (Exo-1,3-beta-glucanase) Length = 445 Score = 32.0 bits (71), Expect = 1.3 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFD 223 NLGGWLV E +I PSLF+ Sbjct: 58 NLGGWLVLEPYITPSLFE 75
>EXG_PICAN (Q12626) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 435 Score = 32.0 bits (71), Expect = 1.3 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGI 229 N+GGWLV E +I PSLF+ + Sbjct: 53 NIGGWLVLEPFITPSLFEAV 72
>EXG1_YEAST (P23776) Glucan 1,3-beta-glucosidase I/II precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase I/II) (Soluble cell wall protein 6) Length = 448 Score = 31.6 bits (70), Expect = 1.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGIPNKD 241 N+GGWL+ E +I PSLF+ D Sbjct: 57 NIGGWLLLEPYITPSLFEAFRTND 80
>EXG_KLULA (Q12628) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 429 Score = 31.6 bits (70), Expect = 1.7 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFD 223 NLGGWLV E +I PSLF+ Sbjct: 40 NLGGWLVLEPFITPSLFE 57
>SPR1_SACBA (Q876J2) Sporulation-specific glucan 1,3-beta-glucosidase precursor| (EC 3.2.1.58) (Exo-1,3-beta-glucanase) Length = 445 Score = 31.2 bits (69), Expect = 2.2 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFD 223 NLGGWLV E +I PS+F+ Sbjct: 58 NLGGWLVLEPYITPSIFE 75
>RF1_MYCLE (P45833) Peptide chain release factor 1 (RF-1)| Length = 361 Score = 30.8 bits (68), Expect = 2.9 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = -1 Query: 424 DELVAEHLQIEGRLVDPP*LEGLPARRLRPVRHQPRAAALLRGHKAVLRHRLELQLRAVQ 245 D L+ EH ++E L DP L PA + R R A ++ H+ ++ R +LQ + Sbjct: 9 DVLLIEHAELELALADPE-LHSNPAEARKAGRRFARLAPIVATHRKLISARDDLQ--TAR 65 Query: 244 EVFVGD 227 E+ GD Sbjct: 66 ELAAGD 71
>EXG_SACKL (Q875R9) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 439 Score = 30.4 bits (67), Expect = 3.8 Identities = 20/65 (30%), Positives = 28/65 (43%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGIPNKDLLDGTQLQFKSVTQDGFVAAEKGGGAGLVANRSQAS 349 N+GGWL+ E +I PSLF+ + D + D + E G VA + Sbjct: 52 NIGGWLLLEPYITPSLFEAFRTDENSDA------GIPVDEYHYCEALGSE--VAESRLEA 103 Query: 350 GWETF 364 W TF Sbjct: 104 HWSTF 108
>EXG_CANAL (P29717) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 438 Score = 30.4 bits (67), Expect = 3.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLFDGIPN 235 NLGGW V E ++ PSLF+ N Sbjct: 57 NLGGWFVLEPYMTPSLFEPFQN 78
>RF1_MYCTU (P66016) Peptide chain release factor 1 (RF-1)| Length = 357 Score = 29.6 bits (65), Expect = 6.5 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = -1 Query: 424 DELVAEHLQIEGRLVDPP*LEGLPARRLRPVRHQPRAAALLRGHKAVLRHRLELQ 260 D L+AEH ++E L DP L PA R R R A ++ H+ + R +L+ Sbjct: 9 DVLLAEHAELELALADPA-LHSNPAEARRVGRRFARLAPIVATHRKLTSARDDLE 62
>RF1_MYCBO (P66017) Peptide chain release factor 1 (RF-1)| Length = 357 Score = 29.6 bits (65), Expect = 6.5 Identities = 19/55 (34%), Positives = 28/55 (50%) Frame = -1 Query: 424 DELVAEHLQIEGRLVDPP*LEGLPARRLRPVRHQPRAAALLRGHKAVLRHRLELQ 260 D L+AEH ++E L DP L PA R R R A ++ H+ + R +L+ Sbjct: 9 DVLLAEHAELELALADPA-LHSNPAEARRVGRRFARLAPIVATHRKLTSARDDLE 62
>EXG_CANOL (Q8NKF9) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 425 Score = 29.6 bits (65), Expect = 6.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 170 NLGGWLVTEGWILPSLF 220 NLGGW V E +I PSLF Sbjct: 41 NLGGWFVLEPYITPSLF 57
>VTS1_NEUCR (Q7RZQ3) Protein VTS1| Length = 610 Score = 29.6 bits (65), Expect = 6.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 251 GTQLQFKSVTQDGFVAAEKGGGAGLVAN 334 G+ LQF S +GF++A GG GL+ N Sbjct: 474 GSALQFTSPQNNGFLSAYDGGAPGLINN 501
>RS20_AZOSE (Q5P102) 30S ribosomal protein S20| Length = 88 Score = 29.6 bits (65), Expect = 6.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 331 RHQPRAAALLRGHKAVLRHRLELQLRAVQEVFVG 230 R + R A + R H LR RL ++AVQ+ VG Sbjct: 8 RKRARQAVVARAHNGSLRSRLRTAIKAVQKAVVG 41
>ZN236_HUMAN (Q9UL36) Zinc finger protein 236| Length = 1845 Score = 29.3 bits (64), Expect = 8.5 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 443 SVVATATSPGKSETFRLVRNAGQNRMRIMAANGLFLQANKDSS 571 S++ +S G + T RL++ + Q + + A FL+ N+D S Sbjct: 921 SLLQAPSSDGMNVTTRLIQESSQEELDLQAQGSQFLEDNEDQS 963
>EXG2_YEAST (P52911) Glucan 1,3-beta-glucosidase 2 precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase 2) Length = 562 Score = 29.3 bits (64), Expect = 8.5 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 173 LGGWLVTEGWILPSLF 220 +GGWLVTE +I PSL+ Sbjct: 60 IGGWLVTEPYITPSLY 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,636,696 Number of Sequences: 219361 Number of extensions: 944205 Number of successful extensions: 3329 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 3264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3328 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)