Clone Name | bart46b10 |
---|---|
Clone Library Name | barley_pub |
>XIP1_WHEAT (Q8L5C6) Xylanase inhibitor protein 1 precursor (Class III| chitinase homolog) (XIP-I protein) Length = 304 Score = 50.4 bits (119), Expect = 1e-06 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 11 MAPLPPSEGACLLPLLSVVPALFLTPPALAGGGKTG 118 MAPL ACLL LLSV ALFLTP ALA GGKTG Sbjct: 1 MAPLAARRPACLLALLSVAAALFLTPTALAAGGKTG 36
>PMP13_CHLPN (Q9Z896) Probable outer membrane protein pmp13 precursor| (Polymorphic membrane protein 13) (Outer membrane protein 14) Length = 973 Score = 28.5 bits (62), Expect = 5.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 14 APLPPSEGACLLPLLSVVPALFLTPPA 94 AP PP + PLL A+F TPPA Sbjct: 296 APTPPPTPPAVTPLLGYGGAIFCTPPA 322
>RPA1_TRYBB (P16355) DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6)| Length = 1744 Score = 28.1 bits (61), Expect = 7.2 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -2 Query: 90 GGVRNKAGTTERRGRRHAPSDGGS--GAIFG 4 GG++ +G +R+ +R P DGG G FG Sbjct: 1347 GGMKGGSGRADRKRKRSGPDDGGGPLGGTFG 1377
>CO1A1_BOVIN (P02453) Collagen alpha-1(I) chain (Fragments)| Length = 779 Score = 27.7 bits (60), Expect = 9.3 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 117 PVFPP-PAKAGGVRNKAGTTERRGRRHAPSDGG 22 P+ PP PA A G + +AG + G R AP D G Sbjct: 333 PIGPPGPAGAPGDKGEAGPSGPAGTRGAPGDRG 365
>ADA2C_HUMAN (P18825) Alpha-2C adrenergic receptor (Alpha-2C adrenoceptor)| (Alpha-2C adrenoreceptor) (Alpha-2 adrenergic receptor subtype C4) Length = 462 Score = 27.7 bits (60), Expect = 9.3 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 8/43 (18%) Frame = -2 Query: 108 PPPAK--------AGGVRNKAGTTERRGRRHAPSDGGSGAIFG 4 PPPA A R + G R GRR A ++GG+G G Sbjct: 278 PPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADG 320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.147 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,104,539 Number of Sequences: 219361 Number of extensions: 275190 Number of successful extensions: 921 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 80,573,946 effective HSP length: 14 effective length of database: 77,502,892 effective search space used: 1860069408 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)