ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bart45g10 |
|---|---|
| Clone Library Name | barley_pub |
>CD2_HORSE (P37998) T-cell surface antigen CD2 precursor| Length = 347 Score = 32.0 bits (71), Expect = 0.46 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 11 NKAFVERREKKPNQTPGMATVAMDISKPPPAASGDESAKGAR 136 +K E R +KP+Q PG + S+PPP S A G R Sbjct: 250 HKVISEERGRKPHQIPGSTPLNPAASQPPPPPSHRPQAPGHR 291
>PRS8_XENLA (P46470) 26S protease regulatory subunit 8 (SUG1 homolog) (xSUG1)| Length = 461 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 140 GGEGLRQYYLQHIHDLQ 190 GG GLRQYYL I DLQ Sbjct: 11 GGTGLRQYYLSKIEDLQ 27
>P100_HCMVA (P08318) Large structural phosphoprotein (pp150) (150 kDa matrix| phosphoprotein) (Basic phosphoprotein) (BPP) (Tegument protein UL32) Length = 1048 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 53 TPGMATVAMDISKPPPAASGDESAKGARGGGE 148 T GM TVA D+S P + +G + GG + Sbjct: 996 TTGMKTVAFDLSSPQKSGTGPQPGSAGMGGAK 1027
>BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231)| Length = 3925 Score = 29.3 bits (64), Expect = 3.0 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 2 RPRNKAFVERREKKPNQTPGMATVAMDISKPPPAASGDESAKGARGGGEG 151 RP R E P TP A P P A A A GGG G Sbjct: 2297 RPEMPVGAAREEPLPTTTPAAIKEAAGAPAPAPLAGQKPPADAAPGGGSG 2346
>ARI1A_HUMAN (O14497) AT-rich interactive domain-containing protein 1A (ARID| domain-containing protein 1A) (SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1) (SWI-SNF complex protein p270) (B120) (SWI-like pr Length = 2285 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 9/40 (22%) Frame = +2 Query: 53 TPGMATVAMDISKPPPAASGDESAK---------GARGGG 145 TPG A SKPPP++S S+ GA GGG Sbjct: 238 TPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGG 277
>PRS8_RAT (P62198) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (Thyroid hormone receptor-interacting protein 1) (TRIP1) Length = 406 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 101 AASGDESAKGARG-GGEGLRQYYLQHIHDLQ 190 A G E + G G GLRQYYL I +LQ Sbjct: 2 ALDGPEQMELEEGKAGSGLRQYYLSKIEELQ 32
>PRS8_PIG (P62197) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (TAT-binding protein homolog 10) (TBP10) Length = 406 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 101 AASGDESAKGARG-GGEGLRQYYLQHIHDLQ 190 A G E + G G GLRQYYL I +LQ Sbjct: 2 ALDGPEQMELEEGKAGSGLRQYYLSKIEELQ 32
>PRS8_MOUSE (P62196) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (mSUG1) Length = 406 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 101 AASGDESAKGARG-GGEGLRQYYLQHIHDLQ 190 A G E + G G GLRQYYL I +LQ Sbjct: 2 ALDGPEQMELEEGKAGSGLRQYYLSKIEELQ 32
>PRS8_HUMAN (P62195) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) (Thyroid hormone receptor-interacting protein 1) (TRIP1) Length = 406 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 101 AASGDESAKGARG-GGEGLRQYYLQHIHDLQ 190 A G E + G G GLRQYYL I +LQ Sbjct: 2 ALDGPEQMELEEGKAGSGLRQYYLSKIEELQ 32
>PRS8_BOVIN (P62194) 26S protease regulatory subunit 8 (Proteasome subunit p45)| (p45/SUG) (Proteasome 26S subunit ATPase 5) Length = 406 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 101 AASGDESAKGARG-GGEGLRQYYLQHIHDLQ 190 A G E + G G GLRQYYL I +LQ Sbjct: 2 ALDGPEQMELEEGKAGSGLRQYYLSKIEELQ 32
>HNRPG_RAT (P84586) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)| (RNA-binding motif protein, X chromosome) Length = 388 Score = 27.7 bits (60), Expect = 8.7 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 8 RNKAFVERREKKPNQTPGMATVAMDISKPPPAASGDESAKGA-RGGGEG 151 R+ + R++ Q G+ +M+ PPP S S++GA RGGG G Sbjct: 328 RSDLYSSGRDRVGRQERGLPP-SMERGYPPPRDSYSSSSRGAPRGGGRG 375
>HNRPG_MOUSE (O35479) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)| (RNA-binding motif protein, X chromosome) Length = 388 Score = 27.7 bits (60), Expect = 8.7 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 8 RNKAFVERREKKPNQTPGMATVAMDISKPPPAASGDESAKGA-RGGGEG 151 R+ + R++ Q G+ +M+ PPP S S++GA RGGG G Sbjct: 328 RSDLYSSGRDRVGRQERGLPP-SMERGYPPPRDSYSSSSRGAPRGGGRG 375
>RANB9_HUMAN (Q96S59) Ran-binding protein 9 (RanBP9) (RanBP7) (Ran-binding| protein M) (RanBPM) (BPM90) (BPM-L) Length = 729 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 26 ERREKKPNQTPGMATVAMDISKPPPAASGDESAKGARGGGEG 151 ++++ P +A V+ + PPA S S G+ GGG G Sbjct: 15 QQQQLSPPPPAALAPVSGVVLPAPPAVSAGSSPAGSPGGGAG 56
>HNRPG_HUMAN (P38159) Heterogeneous nuclear ribonucleoprotein G (hnRNP G)| (RNA-binding motif protein, X chromosome) (Glycoprotein p43) Length = 391 Score = 27.7 bits (60), Expect = 8.7 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 8 RNKAFVERREKKPNQTPGMATVAMDISKPPPAASGDESAKGA-RGGGEG 151 R+ + R++ Q G+ +M+ PPP S S++GA RGGG G Sbjct: 331 RSDLYSSGRDRVGRQERGLPP-SMERGYPPPRDSYSSSSRGAPRGGGRG 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,501,922 Number of Sequences: 219361 Number of extensions: 221237 Number of successful extensions: 1454 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1448 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
