Clone Name | bart45f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1620_HAEIN (P44273) Hypothetical protein HI1620 | 30 | 4.8 | 2 | SURF4_CAEEL (Q18864) Surfeit locus protein 4 homolog | 30 | 4.8 | 3 | OPS2_DROME (P08099) Opsin Rh2 (Ocellar opsin) | 29 | 8.2 |
---|
>Y1620_HAEIN (P44273) Hypothetical protein HI1620| Length = 167 Score = 29.6 bits (65), Expect = 4.8 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 330 VILFLLWGLCCCKIGWDSVMRMSVDLRDLFLYEAFLYYNPLLLVALMIWLWGIN 491 + + L+W KIG + + ++ + + L E LLL++L ++LW IN Sbjct: 66 IFIVLMWATLSWKIGENGI---ELNFQGIELAEKLSLRTHLLLISLWLFLWNIN 116
>SURF4_CAEEL (Q18864) Surfeit locus protein 4 homolog| Length = 277 Score = 29.6 bits (65), Expect = 4.8 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = +3 Query: 330 VILFLLWGLCCCKIGWDSVMRMSVDLRDLFLYEAFLYYNPLLLVALMIWLWGINLWV 500 +++F+ L ++ + V+ + V L + Y L + L+IWL+G+NLW+ Sbjct: 172 LLIFMFMSLMHFEMSFMQVLEIVVGFA-LITLVSIGYKTKLSAIVLVIWLFGLNLWL 227
>OPS2_DROME (P08099) Opsin Rh2 (Ocellar opsin)| Length = 381 Score = 28.9 bits (63), Expect = 8.2 Identities = 20/67 (29%), Positives = 27/67 (40%), Gaps = 11/67 (16%) Frame = +3 Query: 309 LFLWRVKVILFLL----WG-------LCCCKIGWDSVMRMSVDLRDLFLYEAFLYYNPLL 455 LF+W + V ++ W L C I D + RM L Y F+YY PL Sbjct: 178 LFIWMMAVFWTVMPLIGWSAYVPEGNLTACSI--DYMTRMWNPRSYLITYSLFVYYTPLF 235 Query: 456 LVALMIW 476 L+ W Sbjct: 236 LICYSYW 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,391,444 Number of Sequences: 219361 Number of extensions: 898514 Number of successful extensions: 2637 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2637 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)