Clone Name | bart45b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PQQE_METCA (Q608P0) Coenzyme PQQ synthesis protein E (Pyrroloqui... | 28 | 9.1 | 2 | MIAA_MYCTU (P65352) tRNA delta(2)-isopentenylpyrophosphate trans... | 28 | 9.1 | 3 | MIAA_MYCBO (P65353) tRNA delta(2)-isopentenylpyrophosphate trans... | 28 | 9.1 |
---|
>PQQE_METCA (Q608P0) Coenzyme PQQ synthesis protein E (Pyrroloquinoline quinone| biosynthesis protein E) Length = 373 Score = 27.7 bits (60), Expect = 9.1 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 1 PDHHRLLATLARHGRLAAAATLFSTAVRTTRAL 99 P HHR+L +A R A+ LF R +RAL Sbjct: 339 PHHHRVLEAIASTQRSASDKPLFFRNARNSRAL 371
>MIAA_MYCTU (P65352) tRNA delta(2)-isopentenylpyrophosphate transferase (EC| 2.5.1.8) (IPP transferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPTase) (IPPT) Length = 314 Score = 27.7 bits (60), Expect = 9.1 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = +1 Query: 13 RLLATLARHGRLAAAATLFSTAVRTTRALNTI 108 RL A LAR AAAA L + A RT RAL + Sbjct: 138 RLHAELARRDPAAAAAILPTDARRTVRALEVV 169
>MIAA_MYCBO (P65353) tRNA delta(2)-isopentenylpyrophosphate transferase (EC| 2.5.1.8) (IPP transferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPTase) (IPPT) Length = 314 Score = 27.7 bits (60), Expect = 9.1 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = +1 Query: 13 RLLATLARHGRLAAAATLFSTAVRTTRALNTI 108 RL A LAR AAAA L + A RT RAL + Sbjct: 138 RLHAELARRDPAAAAAILPTDARRTVRALEVV 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,613,765 Number of Sequences: 219361 Number of extensions: 49502 Number of successful extensions: 255 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)