Clone Name | bart45a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YAT9_SCHPO (Q10154) Hypothetical protein C1D4.09c in chromosome I | 33 | 0.36 |
---|
>YAT9_SCHPO (Q10154) Hypothetical protein C1D4.09c in chromosome I| Length = 240 Score = 33.5 bits (75), Expect = 0.36 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +3 Query: 402 LAKKPDKADP------NEARLSRFTCCALSGEPLAPPAVVDRLGNLF 524 L K+P K P + S+F+ CA++ EPL PP V LG L+ Sbjct: 14 LVKEPGKVPPLDIDFKRSVKSSQFSQCAITDEPLYPPIVSCGLGKLY 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,747,274 Number of Sequences: 219361 Number of extensions: 277853 Number of successful extensions: 1094 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1094 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)