Clone Name | bart44e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RPOB_CYACA (Q9TM35) DNA-directed RNA polymerase beta chain (EC 2... | 29 | 2.9 | 2 | AAS_ECO57 (Q8X6J8) AAS bifunctional protein [Includes: 2-acylgly... | 28 | 6.6 |
---|
>RPOB_CYACA (Q9TM35) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta subunit) (RNA polymerase beta subunit) Length = 1081 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 95 PLIHALRPLLGSGKHAGVACDSWVLGVEAHN 187 PLI RPL+G+G A +A DS ++ + N Sbjct: 552 PLIFPERPLVGTGLEAQIAKDSGIMAISRSN 582
>AAS_ECO57 (Q8X6J8) AAS bifunctional protein [Includes:| 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40) (Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase) (2-acyl-GPE acyltransferase); Acyl-[acyl-carrier-protein] synthetase (EC 6 Length = 719 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 Query: 116 PLLGSGKHAGVACDSWVLGVEAHN 187 PLLGSGK V SWV VE H+ Sbjct: 695 PLLGSGKPDFVTLKSWVDEVEQHD 718 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,277,236 Number of Sequences: 219361 Number of extensions: 240361 Number of successful extensions: 791 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)