| Clone Name | bart44e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBF1_MOUSE (P25976) Nucleolar transcription factor 1 (Upstream-b... | 31 | 2.6 | 2 | CHLD_TOBAC (O24133) Magnesium-chelatase subunit chlD, chloroplas... | 30 | 3.3 | 3 | BEGIN_HUMAN (Q9BUH8) Brain-enriched guanylate kinase-associated ... | 29 | 9.7 | 4 | YIQ1_YEAST (P40449) Hypothetical 27.1 kDa protein in SUC2-FOX3 i... | 29 | 9.7 |
|---|
>UBF1_MOUSE (P25976) Nucleolar transcription factor 1 (Upstream-binding factor| 1) (UBF-1) Length = 765 Score = 30.8 bits (68), Expect = 2.6 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +2 Query: 5 KLRPPNPQRKSSQAKPNTRRFSREEDMEERRNDSQRQE 118 KLR PNP KSS+ ++ S E+D EE +D + +E Sbjct: 658 KLRGPNP--KSSRTTLQSKSESEEDDDEEEEDDEEEEE 693
>CHLD_TOBAC (O24133) Magnesium-chelatase subunit chlD, chloroplast precursor| (EC 6.6.1.1) (Mg-protoporphyrin IX chelatase) (Mg-chelatase subunit D) Length = 758 Score = 30.4 bits (67), Expect = 3.3 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 14 PPNPQRKSSQAKPNTRRFSREEDME-ERRNDSQRQEPTV 127 PP PQ + S + N EED E E+ ++++Q+P V Sbjct: 413 PPPPQNQDSSEEQNEEEEKEEEDQEDEKDRENEQQQPQV 451
>BEGIN_HUMAN (Q9BUH8) Brain-enriched guanylate kinase-associated protein| Length = 593 Score = 28.9 bits (63), Expect = 9.7 Identities = 31/92 (33%), Positives = 38/92 (41%), Gaps = 8/92 (8%) Frame = -2 Query: 498 EPLFRGDRAGEDAAEAPGVQRQ*LSGEAPSRXXXXXXXXXXXXXXDPTEEFRASSRNSL- 322 EP F RAG D + +PG L G APS + E SR+SL Sbjct: 489 EPCFL--RAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLE 546 Query: 321 PSG------LRPGACAS-SKARPNTG*NGLMR 247 PS + P A S +A P TG +GL R Sbjct: 547 PSSMEASPEMHPAARLSPQQAFPRTGGSGLSR 578
>YIQ1_YEAST (P40449) Hypothetical 27.1 kDa protein in SUC2-FOX3 intergenic| region Length = 235 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +2 Query: 5 KLRPPNPQRKSSQA--KPNTRRFSREEDMEERRNDSQRQE 118 K + N +RK++ K NT +S+E ++EER+ ++RQE Sbjct: 74 KSQAKNRRRKNNNGANKKNTLHYSKEINVEERKQIAKRQE 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,123,360 Number of Sequences: 219361 Number of extensions: 763509 Number of successful extensions: 2845 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2840 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)