| Clone Name | bart43g01 |
|---|---|
| Clone Library Name | barley_pub |
>TMED3_HUMAN (Q9Y3Q3) Transmembrane emp24 domain-containing protein 3 precursor| (Membrane protein p24B) Length = 217 Score = 48.1 bits (113), Expect = 2e-05 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 2/93 (2%) Frame = +3 Query: 297 ECIHEFVPYEGDSVTGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKSGDEFEFK 476 +C HE V +G + ++ V+ + H +D V P GNT+Y K D F ++ Sbjct: 39 QCFHEEVE-QGVKFSLDYQVI------TGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYR 91 Query: 477 APRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 A G+Y+FCF N + + +TV F VG P Sbjct: 92 AEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEP 124
>TMED3_MOUSE (Q78IS1) Transmembrane emp24 domain-containing protein 3 precursor| Length = 221 Score = 47.0 bits (110), Expect = 4e-05 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 2/93 (2%) Frame = +3 Query: 297 ECIHEFVPYEGDSVTGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKSGDEFEFK 476 +C HE V +G + ++ V+ + H +D V P GN +Y K D F +K Sbjct: 43 QCFHEEVE-QGVKFSLDYQVI------TGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYK 95 Query: 477 APRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 G+Y+FCF N + + +TV F VG P Sbjct: 96 TEAKGVYRFCFSNEFSTFSHKTVYFDFQVGDEP 128
>TMED7_HUMAN (Q9Y3B3) Transmembrane emp24 domain-containing protein 7 precursor| Length = 224 Score = 46.6 bits (109), Expect = 5e-05 Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 2/93 (2%) Frame = +3 Query: 297 ECIHEFVPYEGDSVTGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKSGDEFEFK 476 +C +E + +G T F V+ + H +D + P G +Y K D F F Sbjct: 47 QCFYEDIA-QGTKCTLEFQVI------TGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFT 99 Query: 477 APRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 A + G YKFCF N + +TV F VG P Sbjct: 100 ASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDP 132
>TMED3_RAT (Q6AY25) Transmembrane emp24 domain-containing protein 3 precursor| Length = 221 Score = 45.4 bits (106), Expect = 1e-04 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 2/93 (2%) Frame = +3 Query: 297 ECIHEFVPYEGDSVTGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKSGDEFEFK 476 +C HE V +G + ++ V+ + H +D V P GN +Y K D F +K Sbjct: 43 QCFHEEVE-QGVKFSLDYQVI------TGGHYDVDCYVEDPMGNIIYRETKKQYDSFTYK 95 Query: 477 APRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 G+Y+FCF N + + +TV F VG P Sbjct: 96 TEVKGVYRFCFSNEFSTFSHKTVYFDFQVGDEP 128
>TMED2_RAT (Q63524) Transmembrane emp24 domain trafficking protein 2 precursor| (Membrane protein p24A) (RNP21.4) Length = 201 Score = 41.6 bits (96), Expect = 0.002 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 396 IDLTVTSPGGNTVYTMKGKSGDEFEFKAPRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 ID+ +T P +Y +S ++ F A G YKFCF N P+ V F I +G P Sbjct: 57 IDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAP 116
>TMED2_MOUSE (Q9R0Q3) Transmembrane emp24 domain trafficking protein 2 precursor| (Membrane protein p24A) (Sid 394) Length = 201 Score = 41.6 bits (96), Expect = 0.002 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 396 IDLTVTSPGGNTVYTMKGKSGDEFEFKAPRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 ID+ +T P +Y +S ++ F A G YKFCF N P+ V F I +G P Sbjct: 57 IDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAP 116
>TMED2_HUMAN (Q15363) Transmembrane emp24 domain trafficking protein 2 precursor| (Membrane protein p24A) Length = 201 Score = 41.6 bits (96), Expect = 0.002 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 396 IDLTVTSPGGNTVYTMKGKSGDEFEFKAPRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 ID+ +T P +Y +S ++ F A G YKFCF N P+ V F I +G P Sbjct: 57 IDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAP 116
>TMED2_CRIGR (P49020) Transmembrane emp24 domain trafficking protein 2 precursor| (COPI-coated vesicle membrane protein p24) (Fragment) Length = 196 Score = 41.6 bits (96), Expect = 0.002 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 396 IDLTVTSPGGNTVYTMKGKSGDEFEFKAPRGGMYKFCFHNPYG--APETVSFYIHVGHIP 569 ID+ +T P +Y +S ++ F A G YKFCF N P+ V F I +G P Sbjct: 52 IDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAP 111
>ERP2_YEAST (P39704) Protein ERP2 precursor| Length = 215 Score = 41.2 bits (95), Expect = 0.002 Identities = 25/83 (30%), Positives = 39/83 (46%) Frame = +3 Query: 276 SVTVTDTECIHEFVPYEGDSVTGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKS 455 S+ EC++ + E DS+ + V+ F ID +T+P G+ + + K K Sbjct: 35 SLPAFSKECLYYDMVTEDDSLAVGYQVLTGGNF------EIDFDITAPDGSVITSEKQKK 88 Query: 456 GDEFEFKAPRGGMYKFCFHNPYG 524 +F K+ G Y FCF N YG Sbjct: 89 YSDFLLKSFGVGKYTFCFSNNYG 111
>SEL9_CAEEL (O17528) Suppressor/enhancer of lin-12 protein 9 precursor| Length = 203 Score = 37.0 bits (84), Expect = 0.041 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 396 IDLTVTSPGGNTVYTMKGKSGDEFEFKAPRGGMYKFCFHNPYG--APETVSFYIHV 557 ID+ +T P +Y + +S +F F A G+Y +CF N P+ V F + + Sbjct: 55 IDVKITGPDNKEIYKGERESSGKFTFAAHMDGVYTYCFGNKMSTMTPKAVMFTVEI 110
>ERP4_YEAST (Q12450) Protein ERP4 precursor| Length = 207 Score = 36.2 bits (82), Expect = 0.070 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 396 IDLTVTSPGGNTVYTMKGKSGDEFEFKAPRGGMYKFCFHNPYG 524 ID +T+P G+ + T + K +F K+ G Y FC N YG Sbjct: 64 IDFDITAPDGSVIVTERQKKHSDFLLKSFGIGKYTFCLSNNYG 106
>GPI8_YEAST (P49018) GPI-anchor transamidase precursor (EC 3.-.-.-) (GPI| transamidase) Length = 411 Score = 30.0 bits (66), Expect = 5.0 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +3 Query: 315 VPYEGDSVT-GNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKSGDEF 467 V Y G VT NF+ + D W+ DHP +T N M G GD+F Sbjct: 112 VDYRGYEVTVENFIRLLTDR-WTEDHPKSKRLLTDENSNIFIYMTGHGGDDF 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,242,358 Number of Sequences: 219361 Number of extensions: 1024490 Number of successful extensions: 2921 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2921 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)