| Clone Name | bart42d08 |
|---|---|
| Clone Library Name | barley_pub |
>YDZB_SCHPO (O13718) Hypothetical protein C14C4.11 in chromosome I| Length = 734 Score = 30.8 bits (68), Expect = 2.2 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 9/45 (20%) Frame = +1 Query: 196 WKDEFLSYNELK---------PVIGAVSPAEFVARLDVQIEKINA 303 W+D++++Y ELK P G ++FV+ +D Q+EK+ A Sbjct: 15 WRDKYMNYPELKHLLKTEEEAPSWGENDESKFVSVMDAQLEKVYA 59
>BAZ2A_HUMAN (Q9UIF9) Bromodomain adjacent to zinc finger domain 2A (Transcription| termination factor I-interacting protein 5) (TTF-I-interacting protein 5) (Tip5) (hWALp3) Length = 1878 Score = 30.0 bits (66), Expect = 3.8 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -3 Query: 146 MACKSIQRPPTAFCSTNPQPKSTNLASSRAMQRQS 42 M C + PP A P P LASS+ M R S Sbjct: 1303 MPCNAAPTPPPAVSEDQPTPSPQQLASSKPMNRPS 1337
>PHO87_YEAST (P25360) Inorganic phosphate transporter PHO87| Length = 923 Score = 29.3 bits (64), Expect = 6.5 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 145 MKFGKWLKRQIEQSLPAWKDEFLSYNELKPVI 240 M+F +LK ++P W++ +L YNELK +I Sbjct: 1 MRFSHFLKYN---AVPEWQNHYLDYNELKNLI 29
>COX5_SCHPO (O74988) Cytochrome c oxidase polypeptide V, mitochondrial| precursor (EC 1.9.3.1) Length = 174 Score = 29.3 bits (64), Expect = 6.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 73 RLVDFG--WGLVEQKAVGGLWIDLHAMKFGKWLKRQIEQSLPAW 198 RLVD WG++ Q+ GL DL+A + W IE+ A+ Sbjct: 35 RLVDLDKRWGIMSQEEKDGLITDLYARQKQPWTTLSIEEKKAAY 78
>PEO1_HUMAN (Q96RR1) Twinkle protein, mitochondrial precursor (EC 3.6.1.-) (T7| gp4-like protein with intramitochondrial nucleoid localization) (T7-like mitochondrial DNA helicase) (Progressive external ophthalmoplegia 1 protein) Length = 684 Score = 28.9 bits (63), Expect = 8.5 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +1 Query: 136 LHAMKFGKWLKRQIEQSLPAWKDEFLSYNELK-PVIGAVSPAEFVARL 276 L A+ G L R + +LPAW +S+ +L+ V+G +S E A L Sbjct: 343 LEALNGGFNLSRILRTALPAWHKSIVSFRQLREEVLGELSNVEQAAGL 390 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,546,050 Number of Sequences: 219361 Number of extensions: 852348 Number of successful extensions: 2606 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2606 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)