Clone Name | bart42b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip ... | 68 | 8e-12 | 2 | CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chiti... | 65 | 7e-11 |
---|
>CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip bulb| chitinase-1) (TBC-1) Length = 314 Score = 67.8 bits (164), Expect = 8e-12 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +3 Query: 6 PMTNGNLFREYIGGRVTGVRFSDVPVNTGVSFHYILAFAIDYTPVAQKPTPTPTN 170 P+T+ +FREYIG + V+FSDVP+N V FH+ILAFAIDYT +PTPTN Sbjct: 22 PLTSALVFREYIGSQFNDVKFSDVPINPDVDFHFILAFAIDYT---SGSSPTPTN 73
>CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chitinase-2) (TBC-2)| Length = 275 Score = 64.7 bits (156), Expect = 7e-11 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = +3 Query: 24 LFREYIGGRVTGVRFSDVPVNTGVSFHYILAFAIDYTPVAQKPTPTPTN 170 LFREYIG + V+FSDVP+N V FH+ILAFAIDYT +PTPTN Sbjct: 2 LFREYIGAQFNDVKFSDVPINPNVDFHFILAFAIDYT---SGSSPTPTN 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,005,667 Number of Sequences: 219361 Number of extensions: 248002 Number of successful extensions: 880 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)