| Clone Name | bart41b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PMD1_YEAST (P32634) Negative regulator of sporulation PMD1 | 29 | 5.7 | 2 | Y015_BUCBP (P59471) UPF0161 protein bbp_015 | 29 | 5.7 | 3 | UROM_CANFA (Q862Z3) Uromodulin precursor (Tamm-Horsfall urinary ... | 29 | 7.5 | 4 | HLES_DROME (Q02308) Protein hairless | 28 | 9.7 |
|---|
>PMD1_YEAST (P32634) Negative regulator of sporulation PMD1| Length = 1753 Score = 29.3 bits (64), Expect = 5.7 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -2 Query: 380 LGAKRSSSRYTVASDIPPPPAPSRSATDG 294 LG S R T AS + PPP +S DG Sbjct: 771 LGLSEQSGRSTRASSVSPPPVYKKSTNDG 799
>Y015_BUCBP (P59471) UPF0161 protein bbp_015| Length = 85 Score = 29.3 bits (64), Expect = 5.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 383 SRCMLVYLHCICNYVSVSLSPYC 451 SRC+++ + C Y+SV LSP C Sbjct: 9 SRCLILIILCYQRYISVFLSPRC 31
>UROM_CANFA (Q862Z3) Uromodulin precursor (Tamm-Horsfall urinary glycoprotein)| (THP) Length = 642 Score = 28.9 bits (63), Expect = 7.5 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +2 Query: 395 LVYLHC---ICNYVSVSLSPYCSETLCRNSG 478 LVYLHC +C+ ++ P CS T R+ G Sbjct: 562 LVYLHCEVYLCDIINEKCKPTCSGTRFRSGG 592
>HLES_DROME (Q02308) Protein hairless| Length = 1077 Score = 28.5 bits (62), Expect = 9.7 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +1 Query: 169 GELSAALRGKKRQAVPA--MSHAEH-QHQMXXXXXXXXXXXXXTKPSVADLEGAGGGG 333 G S++ GKK PA +S+ H QH M T P D+ G+ GGG Sbjct: 676 GSSSSSSSGKKCGDHPAAIISNVHHPQHSMYQPSSSSYPRALLTSPKSPDVSGSNGGG 733 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,659,910 Number of Sequences: 219361 Number of extensions: 1019700 Number of successful extensions: 3148 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3137 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)