Clone Name | bart40e09 |
---|---|
Clone Library Name | barley_pub |
>SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4| Length = 489 Score = 32.0 bits (71), Expect = 1.1 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 382 PSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSR 489 P++PA R S RSRS++P+ + + +PSRSR Sbjct: 447 PNVPAESRSRSKSASKTRSRSKSPSRSASRSPSRSR 482
>UL06_HHV11 (P10190) Virion protein UL6| Length = 676 Score = 32.0 bits (71), Expect = 1.1 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +1 Query: 379 PPSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSRFMARRKQRRRGR 525 PP P G PG RSRSR+P P + + R RR GR Sbjct: 627 PPPSPVGADFRPGASPRGRSRSRSPGRTARGAPDQGGGIGHRDGRRDGR 675
>BRPF1_HUMAN (P55201) Peregrin (Bromodomain and PHD finger-containing protein 1)| (BR140 protein) Length = 1214 Score = 31.6 bits (70), Expect = 1.4 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 394 AGKRKSPGMLSWRRSRSRTPTHAQTPT-PSRSRFMARRKQRRRGR 525 AG K PG R TP+H +P P + M+ +QR+RGR Sbjct: 902 AGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGR 946
>VE2_HPV49 (P36795) Regulatory protein E2| Length = 488 Score = 30.4 bits (67), Expect = 3.1 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 385 SLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSRFMARRKQRRR 519 S P S +S RRSRSRT T + + SRS+ +R + R R Sbjct: 266 SSPTAASNSRKEVSRRRSRSRTRTRRREASTSRSQKASRSRSRSR 310
>MRIP_MOUSE (P97434) Myosin phosphatase Rho-interacting protein| (Rho-interacting protein 3) (p116Rip) (RIP3) Length = 1024 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +1 Query: 385 SLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSRFMARRKQRRRGR 525 SLP GK KS + RS + P P + + A R++RR GR Sbjct: 492 SLPEGKNKSTSFETCSRSTEKQEAEPGEPDPEQKKSRA-RERRREGR 537
>VE2_HPV24 (P50770) Regulatory protein E2| Length = 467 Score = 29.6 bits (65), Expect = 5.3 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 19/71 (26%) Frame = +1 Query: 370 TSCPPSLPAGKRKSPGMLSWRRSRSRTPT-------------------HAQTPTPSRSRF 492 +S PP P G R+ PG S S++ +PT +PT SR R Sbjct: 200 SSTPPDSPGGSRELPG--STANSKASSPTQQPQQACSDETTKRKRYGRRESSPTDSRCRR 257 Query: 493 MARRKQRRRGR 525 + +Q+++GR Sbjct: 258 RSSSRQKKQGR 268
>RECQ4_HUMAN (O94761) ATP-dependent DNA helicase Q4 (EC 3.6.1.-) (RecQ| protein-like 4) (RecQ4) (RTS) Length = 1208 Score = 29.6 bits (65), Expect = 5.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 385 SLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSR 489 SLPA ++P W +R T + PTP RSR Sbjct: 64 SLPAAAEEAPEPRCWGPHLNRAATKSPQPTPGRSR 98
>SFR15_RAT (Q63627) Splicing factor, arginine/serine-rich 15 (CTD-binding| SR-like protein RA4) (Fragment) Length = 1048 Score = 29.3 bits (64), Expect = 7.0 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 430 RRSRSRTPTHAQTPTPSRSRFMARRKQRRRGR 525 R+SRSR+P ++ + SRSR R+ R R R Sbjct: 350 RKSRSRSPKRRRSRSGSRSRRSRHRRSRSRSR 381
>YL116_MIMIV (Q5UPJ3) Hypothetical protein L116| Length = 563 Score = 29.3 bits (64), Expect = 7.0 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +1 Query: 373 SCPPSLPAGKRKSPGMLSWR---RSRSRTPTHAQTPTPSRSRFMARRKQRRR 519 SC S + +SP +R RSR R+P ++ +P RSR+ + + R R Sbjct: 127 SCELSSERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSRYR 178
>MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemotaxis protein)| Length = 657 Score = 28.9 bits (63), Expect = 9.1 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -1 Query: 190 TSAAASD*SSWVRRTALGGPWSSEVVSRTR 101 T+AA + ++ VRRTA G +S+VVS TR Sbjct: 386 TAAALDELTATVRRTAAGARQASDVVSTTR 415
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 28.9 bits (63), Expect = 9.1 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 400 KRKSPGMLSWR-RSRSRTPTHAQTPTPSRSRFMARRKQRRR 519 +++SP R RSRSR+P+H++ RSR R RRR Sbjct: 276 RQRSPTRSKSRSRSRSRSPSHSRPRRRHRSRSRRRPSPRRR 316
>DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7)| Length = 1073 Score = 28.9 bits (63), Expect = 9.1 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 306 GISHHRGAFSGPGEVRDHPAFDVVPTELAR 395 G H G SG + D P DVVPTE AR Sbjct: 525 GQPRHLGIHSGGMVICDRPIADVVPTEWAR 554
>SFR11_HUMAN (Q05519) Splicing factor arginine/serine-rich 11 (Arginine-rich 54| kDa nuclear protein) (p54) Length = 484 Score = 28.9 bits (63), Expect = 9.1 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 400 KRKSPGMLSWRRSRSRTPTHAQTPTPSRSRFMARRKQRRRGR 525 +R++P RRSRSR+ + + + SR R + R++R R Sbjct: 257 RRRTPSSSRHRRSRSRSRRRSHSKSRSRRRSKSPRRRRSHSR 298
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 28.9 bits (63), Expect = 9.1 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +1 Query: 394 AGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSRFMARRKQR 513 + + +S LS RSRS T + + +P+PS+SR +R + + Sbjct: 476 SSRSRSSWSLSPSRSRSLTRSRSHSPSPSQSRSRSRSRSQ 515
>CY24A_MOUSE (Q61462) Cytochrome b-245 light chain (p22 phagocyte B-cytochrome)| (Neutrophil cytochrome b 22 kDa polypeptide) (p22-phox) (p22phox) (Cytochrome b(558) alpha chain) (Cytochrome b558 alpha subunit) (Superoxide-generating NADPH oxidase light ch Length = 191 Score = 28.9 bits (63), Expect = 9.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 447 DPDARPDTDAEQKPFHGEEEAAKA 518 +P RP + +KP GEEEAA A Sbjct: 153 NPPPRPPAEVRKKPSEGEEEAASA 176 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,416,312 Number of Sequences: 219361 Number of extensions: 771224 Number of successful extensions: 3810 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3588 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)