Clone Name | bart39e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ML423_ARATH (Q93VR4) MLP-like protein 423 | 32 | 1.8 | 2 | L18A_LUPLU (P52778) Protein LlR18A (LlPR10.1A) | 30 | 4.0 | 3 | MPAC1_CARBE (P38949) Major pollen allergen Car b 1 isoforms 1A a... | 30 | 4.0 | 4 | ZO3_MOUSE (Q9QXY1) Tight junction protein ZO-3 (Zonula occludens... | 29 | 9.0 |
---|
>ML423_ARATH (Q93VR4) MLP-like protein 423| Length = 155 Score = 31.6 bits (70), Expect = 1.8 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 376 AGDDLRPGRLREVSVISGLP-ASTSTERLDLLDDARRAFGFTITGGE 513 AGD PG +R ++ G P S ER++ +D ++ ++I GGE Sbjct: 46 AGDGNAPGSIRLITYGEGSPLVKISAERIEAVDLENKSMSYSIIGGE 92
>L18A_LUPLU (P52778) Protein LlR18A (LlPR10.1A)| Length = 156 Score = 30.4 bits (67), Expect = 4.0 Identities = 14/57 (24%), Positives = 29/57 (50%) Frame = +1 Query: 394 PGRLREVSVISGLPASTSTERLDLLDDARRAFGFTITGGEHRLRNYRSVTTVSELSP 564 PG ++++ I S +LD +D+A + ++I GGE + ++ S++ P Sbjct: 50 PGTIKKIIAIHDGHTSFVLHKLDAIDEANLTYNYSIIGGEGLDESLEKISYESKILP 106
>MPAC1_CARBE (P38949) Major pollen allergen Car b 1 isoforms 1A and 1B (Car B I)| Length = 159 Score = 30.4 bits (67), Expect = 4.0 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 394 PGRLREVSVISGLPASTSTERLDLLDDARRAFGFTITGGE 513 PG ++ ++ G+P ER+D +D+A + +T+ G+ Sbjct: 50 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGD 89
>ZO3_MOUSE (Q9QXY1) Tight junction protein ZO-3 (Zonula occludens 3 protein)| (Zona occludens 3 protein) (Tight junction protein 3) Length = 905 Score = 29.3 bits (64), Expect = 9.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 463 LLDDARRAFGFTITGGEHRLRNYRSVTTVSELSPAAPAE 579 L D RR FG ++GG R VS++ P +PAE Sbjct: 14 LYKDPRRGFGIAVSGGHDRA---SGSVVVSDVVPGSPAE 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,808,970 Number of Sequences: 219361 Number of extensions: 605225 Number of successful extensions: 2322 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2322 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)