Clone Name | bart39d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CLPB_TREDE (Q73K92) Chaperone clpB | 32 | 1.6 | 2 | PEPT_VIBCH (Q9KMY6) Peptidase T (EC 3.4.11.4) (Tripeptide aminop... | 31 | 2.7 |
---|
>CLPB_TREDE (Q73K92) Chaperone clpB| Length = 859 Score = 31.6 bits (70), Expect = 1.6 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = -1 Query: 550 SGDVSTRYTPPASTGSGLVRAVTASFTTDWMSILDSDAPRDIRTSHFSCPSATTADTLAV 371 S D S P + G +RA+ A+ ++ ++ DA + R CP T DT+A+ Sbjct: 292 SMDASNLLKPALARGE--LRAIGATTLNEYRKYIEKDAALERRFQQVYCPEPTVEDTIAI 349 Query: 370 V 368 + Sbjct: 350 L 350
>PEPT_VIBCH (Q9KMY6) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 410 Score = 30.8 bits (68), Expect = 2.7 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = -1 Query: 547 GDVSTRYTPPASTGSGLVRAVTASFTTDWMSILDSDAPRDIRTSHFSCPSAT 392 GD+S +TP G G A F W +D ++ +F+ +AT Sbjct: 164 GDISIAFTPDEEIGRGANHFDVAKFAAQWAYTIDGGPIGELEYENFNAATAT 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,070,244 Number of Sequences: 219361 Number of extensions: 655801 Number of successful extensions: 2283 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2283 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)