Clone Name | bart38b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF2_AGRT5 (Q8UJ51) Translation initiation factor IF-2 | 32 | 1.3 | 2 | YJP1_SCHPO (Q9P6S0) Hypothetical threonine-rich protein C1742.01... | 30 | 4.8 | 3 | CY24B_HUMAN (P04839) Cytochrome b-245 heavy chain (p22 phagocyte... | 29 | 8.1 |
---|
>IF2_AGRT5 (Q8UJ51) Translation initiation factor IF-2| Length = 913 Score = 32.0 bits (71), Expect = 1.3 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 250 QRPHRGVPERHLQPGVLPHRDAAGDDCRPQPQHPRRHLLRPDGRLRR 390 +RPHR E+ +QP V + AA +PQ P+ + +P G+ +R Sbjct: 49 RRPHRPEDEKPVQPVVAAPKPAAPAPVAARPQAPQPRIHQPGGQQQR 95
>YJP1_SCHPO (Q9P6S0) Hypothetical threonine-rich protein C1742.01 precursor| Length = 1563 Score = 30.0 bits (66), Expect = 4.8 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 567 TRTVSST*PAVSSCASATARYGASG--TFDPTRNGDHTETSRWPWYTTGSAVG 415 T TVSST SS ++ Y SG T+ R + + T + +YTTG G Sbjct: 1475 TETVSSTEAPESSTVTSNPIYQGSGTSTWSTVRQWNGSATYNYTYYTTGGFTG 1527
>CY24B_HUMAN (P04839) Cytochrome b-245 heavy chain (p22 phagocyte B-cytochrome)| (Neutrophil cytochrome b 91 kDa polypeptide) (CGD91-phox) (gp91-phox) (gp91-1) (Heme-binding membrane glycoprotein gp91phox) (Cytochrome b(558) beta chain) (Cytochrome b558 be Length = 569 Score = 29.3 bits (64), Expect = 8.1 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 323 TIAARNPNTRVGIYFDRTDAYAEYKGQQ 406 TIA+++PNTR+G++ +A AE +Q Sbjct: 521 TIASQHPNTRIGVFLCGPEALAETLSKQ 548 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,605,327 Number of Sequences: 219361 Number of extensions: 599171 Number of successful extensions: 1966 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1966 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)