| Clone Name | bart37g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CNGC4_ARATH (Q94AS9) Cyclic nucleotide-gated ion channel 4 (AtCN... | 32 | 1.4 | 2 | SERI1_BOMMO (P07856) Sericin 1 precursor (Silk gum protein) | 30 | 5.2 | 3 | STK6_RAT (P59241) Serine/threonine-protein kinase 6 (EC 2.7.11.1... | 30 | 5.2 | 4 | DUT_HHV11 (P10234) Deoxyuridine 5'-triphosphate nucleotidohydrol... | 29 | 8.9 |
|---|
>CNGC4_ARATH (Q94AS9) Cyclic nucleotide-gated ion channel 4 (AtCNGC4) (Cyclic| nucleotide-and calmodulin-regulated ion channel 4) (AtHLM1) Length = 694 Score = 31.6 bits (70), Expect = 1.4 Identities = 27/115 (23%), Positives = 43/115 (37%), Gaps = 7/115 (6%) Frame = +3 Query: 150 HSSPLLRPRSAVSGYLHSTMTSSVLLDSPPQLPAAGAWGS---LYGVQEPSKCQRVPVVK 320 HS LR + +SGY+ T+ + L+ AA A G+ L GVQ +KC + Sbjct: 238 HSIRHLRRNATLSGYIFGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLK----- 292 Query: 321 KKPAYGVKRNLEMCTEALGCEXXXXX----XXXXXXXXXMARKKHAWEQEEETKA 473 E C +GC+ + R + AW Q + ++ Sbjct: 293 -----------EQCENTIGCDLRMLSCKEPVYYGTTVMVLDRARLAWAQNHQARS 336
>SERI1_BOMMO (P07856) Sericin 1 precursor (Silk gum protein)| Length = 1186 Score = 29.6 bits (65), Expect = 5.2 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 207 WWNADSRIPQIEGGAVEMNVGGSTR 133 WWN+D+++ + GGA + ST+ Sbjct: 506 WWNSDNKVQRAAGGATKSGASSSTQ 530
>STK6_RAT (P59241) Serine/threonine-protein kinase 6 (EC 2.7.11.1) (Aurora-A)| (ratAurA) Length = 397 Score = 29.6 bits (65), Expect = 5.2 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = +3 Query: 234 PPQLPAAGAWGSLYGVQEPSKCQRVPVVKKKPAYGVKRNLEMCTEALG 377 P Q P + + G V PS QRVP +KP G K L+ A G Sbjct: 31 PSQHPGSASSGQAQRVLCPSNSQRVPPQAQKPVAGQKPVLKQLPAASG 78
>DUT_HHV11 (P10234) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 371 Score = 28.9 bits (63), Expect = 8.9 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = +2 Query: 113 IAYSPPNLVDPPTF-----ISTAPPSICGIRLSAFHHDQLRAARLTTATPGRR 256 I +PP L +P + ++ PP+ GIR + L A +TTA P RR Sbjct: 131 ILATPPALTEPISLRQFPQLAPPPPTGAGIREDPWLEGALGAPSVTTALPARR 183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,275,194 Number of Sequences: 219361 Number of extensions: 1213852 Number of successful extensions: 3733 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3733 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)