ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bart37g07 |
|---|---|
| Clone Library Name | barley_pub |
>WRK70_ARATH (Q9LY00) Probable WRKY transcription factor 70 (WRKY DNA-binding| protein 70) Length = 294 Score = 54.7 bits (130), Expect = 2e-07 Identities = 25/48 (52%), Positives = 30/48 (62%) Frame = +2 Query: 380 CRTRTHDSSVVTKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCTRKY 523 C R S T + LED +WRKYGQKEI N+K ++YFRCT KY Sbjct: 102 CYKRKKRSETCTIESTILEDAFSWRKYGQKEILNAKFPRSYFRCTHKY 149
>WRK46_ARATH (Q9SKD9) Probable WRKY transcription factor 46 (WRKY DNA-binding| protein 46) Length = 295 Score = 51.2 bits (121), Expect = 2e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCTRKY 523 S++DG WRKYGQKEI SK+ +AY+RCT ++ Sbjct: 102 SIDDGHCWRKYGQKEIHGSKNPRAYYRCTHRF 133
>WRK54_ARATH (Q93WU8) Probable WRKY transcription factor 54 (WRKY DNA-binding| protein 54) Length = 346 Score = 48.1 bits (113), Expect = 1e-05 Identities = 23/47 (48%), Positives = 27/47 (57%) Frame = +2 Query: 380 CRTRTHDSSVVTKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCTRK 520 C TR S + KS ED WRKYGQKEI N+ ++Y RCT K Sbjct: 134 CYTRKTRSHARIVEAKSSEDRYAWRKYGQKEILNTTFPRSYLRCTHK 180 Score = 28.9 bits (63), Expect = 9.2 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 137 QVVDDLAKGQEFATQLQGLL 196 +VVD L +G EFATQLQ LL Sbjct: 14 KVVDQLVEGYEFATQLQLLL 33
>WRK28_ARATH (Q8VWJ2) Probable WRKY transcription factor 28 (WRKY DNA-binding| protein 28) Length = 318 Score = 47.0 bits (110), Expect = 3e-05 Identities = 20/38 (52%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +2 Query: 404 SVVTK-KMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 S +TK ++ LEDG WRKYGQK ++NS + ++Y+RCT Sbjct: 161 SFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCT 198
>WRK13_ARATH (Q9SVB7) Probable WRKY transcription factor 13 (WRKY DNA-binding| protein 13) Length = 304 Score = 47.0 bits (110), Expect = 3e-05 Identities = 16/29 (55%), Positives = 25/29 (86%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCTR 517 L+DG WRKYGQK ++N++H ++Y+RCT+ Sbjct: 222 LDDGYRWRKYGQKVVKNTQHPRSYYRCTQ 250
>WRKY8_ARATH (Q9FL26) Probable WRKY transcription factor 8 (WRKY DNA-binding| protein 8) Length = 326 Score = 47.0 bits (110), Expect = 3e-05 Identities = 20/38 (52%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +2 Query: 404 SVVTK-KMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 S +TK ++ LEDG WRKYGQK ++NS + ++Y+RCT Sbjct: 172 SFMTKTEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCT 209
>WRK12_ARATH (Q93WY4) Probable WRKY transcription factor 12 (WRKY DNA-binding| protein 12) Length = 218 Score = 46.6 bits (109), Expect = 4e-05 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 L+DG WRKYGQK ++NS H ++Y+RCT Sbjct: 144 LDDGYKWRKYGQKVVKNSLHPRSYYRCT 171
>WRK56_ARATH (Q8VWQ4) Probable WRKY transcription factor 56 (WRKY DNA-binding| protein 56) Length = 195 Score = 46.6 bits (109), Expect = 4e-05 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 L+DG WRKYGQK ++N+ H ++Y+RCT Sbjct: 113 LDDGYRWRKYGQKSVKNNAHPRSYYRCT 140
>WRK71_ARATH (Q93WV4) Probable WRKY transcription factor 71 (WRKY DNA-binding| protein 71) Length = 282 Score = 46.2 bits (108), Expect = 6e-05 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 LEDG WRKYGQK ++NS + ++Y+RCT Sbjct: 135 LEDGYRWRKYGQKAVKNSPYPRSYYRCT 162
>WRK57_ARATH (Q9C983) Probable WRKY transcription factor 57 (WRKY DNA-binding| protein 57) Length = 287 Score = 45.8 bits (107), Expect = 7e-05 Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = +2 Query: 383 RTRTHDSSVVTKK-MKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 R R + +TK + +LEDG WRKYGQK ++NS ++Y+RCT Sbjct: 129 RIRQPRFAFMTKSDVDNLEDGYRWRKYGQKAVKNSPFPRSYYRCT 173
>WRK23_ARATH (O22900) Probable WRKY transcription factor 23 (WRKY DNA-binding| protein 23) Length = 337 Score = 45.4 bits (106), Expect = 1e-04 Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = +2 Query: 383 RTRTHDSSVVTK-KMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 R R + +TK ++ LEDG WRKYGQK ++NS ++Y+RCT Sbjct: 156 RQREARVAFMTKSEVDHLEDGYRWRKYGQKAVKNSPFPRSYYRCT 200
>WRK43_ARATH (Q8GY11) Probable WRKY transcription factor 43 (WRKY DNA-binding| protein 43) Length = 109 Score = 45.4 bits (106), Expect = 1e-04 Identities = 16/29 (55%), Positives = 24/29 (82%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCTR 517 L+DG WRKYGQK ++NS + ++Y+RCT+ Sbjct: 29 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQ 57
>WRK26_ARATH (Q9C5T3) Probable WRKY transcription factor 26 (WRKY DNA-binding| protein 26) (SPF1-like protein) Length = 309 Score = 45.4 bits (106), Expect = 1e-04 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = +2 Query: 404 SVVTKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 S + K+ +DG WRKYGQK+++ S++ ++YF+CT Sbjct: 107 SEIMSSNKTSDDGYNWRKYGQKQVKGSENPRSYFKCT 143 Score = 40.4 bits (93), Expect = 0.003 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +2 Query: 413 TKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 T + L+DG WRKYGQK ++ + + ++Y++CT Sbjct: 227 TSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCT 260
>WRK48_ARATH (Q9FGZ4) Probable WRKY transcription factor 48 (WRKY DNA-binding| protein 48) Length = 399 Score = 45.4 bits (106), Expect = 1e-04 Identities = 16/29 (55%), Positives = 24/29 (82%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +L+DG WRKYGQK ++NS + ++Y+RCT Sbjct: 219 NLDDGYRWRKYGQKAVKNSPYPRSYYRCT 247
>WRK75_ARATH (Q9FYA2) Probable WRKY transcription factor 75 (WRKY DNA-binding| protein 75) Length = 145 Score = 45.1 bits (105), Expect = 1e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 L+DG WRKYGQK ++N+K ++Y+RCT Sbjct: 66 LDDGYRWRKYGQKAVKNNKFPRSYYRCT 93
>WRK24_ARATH (Q9FFS3) Probable WRKY transcription factor 24 (WRKY DNA-binding| protein 24) Length = 179 Score = 44.7 bits (104), Expect = 2e-04 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 L+DG WRKYGQK ++++ H ++Y+RCT Sbjct: 97 LDDGYRWRKYGQKSVKHNAHPRSYYRCT 124
>WRK55_ARATH (Q9SHB5) Probable WRKY transcription factor 55 (WRKY DNA-binding| protein 55) Length = 292 Score = 44.7 bits (104), Expect = 2e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 434 EDGQTWRKYGQKEIQNSKHSKAYFRCTRK 520 +D TWRKYGQKEI S+ +AY+RCT + Sbjct: 173 DDNHTWRKYGQKEILGSRFPRAYYRCTHQ 201
>WRK67_ARATH (Q93WV7) Probable WRKY transcription factor 67 (WRKY DNA-binding| protein 67) Length = 254 Score = 44.3 bits (103), Expect = 2e-04 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 DG TWRKYGQK I+ S H + Y+RCT D Sbjct: 109 DGFTWRKYGQKTIKASAHKRCYYRCTYAKD 138
>WRK58_ARATH (Q93WU7) Probable WRKY transcription factor 58 (WRKY DNA-binding| protein 58) Length = 423 Score = 43.9 bits (102), Expect = 3e-04 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +2 Query: 383 RTRTHDSSVVTKKMKS--LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 RT T +V K + L+DG WRKYGQK ++ + H ++Y++CT Sbjct: 287 RTVTEPKIIVQTKSEVDLLDDGYRWRKYGQKVVKGNPHPRSYYKCT 332 Score = 40.8 bits (94), Expect = 0.002 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 K +DG WRKYGQK I+ ++ ++Y++CT Sbjct: 164 KPADDGYNWRKYGQKPIKGCEYPRSYYKCT 193
>WRK30_ARATH (Q9FL62) Probable WRKY transcription factor 30 (WRKY DNA-binding| protein 30) Length = 303 Score = 43.9 bits (102), Expect = 3e-04 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++L+DG +WRKYGQK+I +K + Y+RCT Sbjct: 110 RTLDDGFSWRKYGQKDILGAKFPRGYYRCT 139
>WRK38_ARATH (Q8GWF1) Probable WRKY transcription factor 38 (WRKY DNA-binding| protein 38) Length = 289 Score = 43.5 bits (101), Expect = 4e-04 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 DG WRKYGQK I+ S H ++Y+RC+ D Sbjct: 111 DGYLWRKYGQKSIKKSNHQRSYYRCSYNKD 140
>WRK64_ARATH (Q9C557) Probable WRKY transcription factor 64 (WRKY DNA-binding| protein 64) Length = 249 Score = 43.5 bits (101), Expect = 4e-04 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +2 Query: 434 EDGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 +DG TWRKYGQK I+ S + + Y+RCT D Sbjct: 103 DDGFTWRKYGQKTIKTSPYQRCYYRCTYAKD 133
>WRK33_ARATH (Q8S8P5) Probable WRKY transcription factor 33 (WRKY DNA-binding| protein 33) Length = 512 Score = 43.5 bits (101), Expect = 4e-04 Identities = 14/33 (42%), Positives = 26/33 (78%) Frame = +2 Query: 416 KKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++ + EDG WRKYGQK+++ S++ ++Y++CT Sbjct: 171 REQRKGEDGYNWRKYGQKQVKGSENPRSYYKCT 203 Score = 40.4 bits (93), Expect = 0.003 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +2 Query: 413 TKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 T + L+DG WRKYGQK ++ + + ++Y++CT Sbjct: 348 TSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCT 381
>WRK32_ARATH (P59583) Probable WRKY transcription factor 32 (WRKY DNA-binding| protein 32) Length = 466 Score = 43.1 bits (100), Expect = 5e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 DG WRKYGQK++++ K S++Y+RCT Sbjct: 169 DGYNWRKYGQKQVKSPKGSRSYYRCT 194 Score = 40.0 bits (92), Expect = 0.004 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 DG WRKYGQK ++ + H + Y+RCT Sbjct: 332 DGYRWRKYGQKMVKGNPHPRNYYRCT 357
>WRK63_ARATH (Q9C6H5) Probable WRKY transcription factor 63 (WRKY DNA-binding| protein 63) Length = 241 Score = 42.7 bits (99), Expect = 6e-04 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 L+DG TWRKYGQK I+ S + + Y+RC D Sbjct: 102 LDDGFTWRKYGQKTIKTSLYQRCYYRCAYAKD 133
>WRK49_ARATH (Q9FHR7) Probable WRKY transcription factor 49 (WRKY DNA-binding| protein 49) Length = 274 Score = 42.7 bits (99), Expect = 6e-04 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = +2 Query: 434 EDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +DG WRKYGQK I+NS + ++Y++CT Sbjct: 114 DDGYKWRKYGQKSIKNSPNPRSYYKCT 140
>WRKY3_ARATH (Q9ZQ70) Probable WRKY transcription factor 3 (WRKY DNA-binding| protein 3) Length = 513 Score = 42.4 bits (98), Expect = 8e-04 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = +2 Query: 383 RTRTHDSSVV--TKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 RT T +V T ++ L+DG WRKYGQK ++ + + ++Y++CT Sbjct: 396 RTVTEPRIIVQTTSEVDLLDDGYRWRKYGQKVVKGNPYPRSYYKCT 441 Score = 41.6 bits (96), Expect = 0.001 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 K +DG WRKYGQK+++ S ++Y++CT Sbjct: 247 KPADDGYNWRKYGQKQVKGSDFPRSYYKCT 276
>WRKY4_ARATH (Q9XI90) Probable WRKY transcription factor 4 (WRKY DNA-binding| protein 4) Length = 514 Score = 42.4 bits (98), Expect = 8e-04 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = +2 Query: 383 RTRTHDSSVV--TKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 RT T +V T ++ L+DG WRKYGQK ++ + + ++Y++CT Sbjct: 390 RTVTEPRIIVQTTSEVDLLDDGYRWRKYGQKVVKGNPYPRSYYKCT 435 Score = 42.4 bits (98), Expect = 8e-04 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 K +DG WRKYGQK+++ S+ ++Y++CT Sbjct: 226 KPADDGYNWRKYGQKQVKGSEFPRSYYKCT 255
>WRK68_ARATH (Q93WV6) Probable WRKY transcription factor 68 (WRKY DNA-binding| protein 68) Length = 277 Score = 42.0 bits (97), Expect = 0.001 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +2 Query: 401 SSVVTKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 S + ++ L+DG WRKYGQK +++S + Y+RCT Sbjct: 107 SFITRSEVLHLDDGYKWRKYGQKPVKDSPFPRNYYRCT 144
>WRKY1_ARATH (Q9SI37) WRKY transcription factor 1 (WRKY DNA-binding protein 1)| (Zinc-dependent activator protein 1) (Transcription factor ZAP1) Length = 487 Score = 42.0 bits (97), Expect = 0.001 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 K +EDG WRKYGQK ++ ++ ++Y+RCT Sbjct: 108 KVMEDGYNWRKYGQKLVKGNEFVRSYYRCT 137 Score = 41.2 bits (95), Expect = 0.002 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +2 Query: 392 THDSSVVTKKMKSLE---DGQTWRKYGQKEIQNSKHSKAYFRCT 514 T+DS +V + DG WRKYGQK ++ S + ++Y+RC+ Sbjct: 290 TNDSRIVVHTQTLFDIVNDGYRWRKYGQKSVKGSPYPRSYYRCS 333
>WRK25_ARATH (O22921) Probable WRKY transcription factor 25 (WRKY DNA-binding| protein 25) Length = 393 Score = 42.0 bits (97), Expect = 0.001 Identities = 14/30 (46%), Positives = 24/30 (80%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++ DG WRKYGQK+++ S++ ++YF+CT Sbjct: 163 RNSNDGYGWRKYGQKQVKKSENPRSYFKCT 192 Score = 37.0 bits (84), Expect = 0.034 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 L DG WRKYGQK ++ + + ++Y++CT Sbjct: 327 LIDGFRWRKYGQKVVKGNTNPRSYYKCT 354
>WRK45_ARATH (Q9S763) Probable WRKY transcription factor 45 (WRKY DNA-binding| protein 45) (AT.I.24-4) Length = 147 Score = 42.0 bits (97), Expect = 0.001 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCTRK 520 L+DG WRKYGQK ++N+ ++Y++CT + Sbjct: 64 LDDGYRWRKYGQKAVKNNPFPRSYYKCTEE 93
>WRK44_ARATH (Q9ZUU0) WRKY transcription factor 44 (WRKY DNA-binding protein 44)| (TRANSPARENT TESTA GLABRA 2) Length = 429 Score = 42.0 bits (97), Expect = 0.001 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 SLEDG WRKYGQK + + + ++Y+RCT Sbjct: 347 SLEDGFRWRKYGQKVVGGNAYPRSYYRCT 375 Score = 40.4 bits (93), Expect = 0.003 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +S DG WRKYGQK+++ S+ ++Y++CT Sbjct: 162 RSSVDGYNWRKYGQKQVKGSECPRSYYKCT 191
>WRKY2_ARATH (Q9FG77) Probable WRKY transcription factor 2 (WRKY DNA-binding| protein 2) Length = 687 Score = 41.6 bits (96), Expect = 0.001 Identities = 14/27 (51%), Positives = 22/27 (81%) Frame = +2 Query: 434 EDGQTWRKYGQKEIQNSKHSKAYFRCT 514 EDG WRKYGQK ++ S++ ++Y++CT Sbjct: 273 EDGYNWRKYGQKLVKGSEYPRSYYKCT 299 Score = 40.4 bits (93), Expect = 0.003 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +2 Query: 413 TKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 T + L+DG WRKYGQK ++ + + ++Y++CT Sbjct: 480 TSDVDILDDGYRWRKYGQKVVKGNPNPRSYYKCT 513
>WRK10_ARATH (Q9LG05) Probable WRKY transcription factor 10 (WRKY DNA-binding| protein 10) Length = 506 Score = 41.6 bits (96), Expect = 0.001 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 4/47 (8%) Frame = +2 Query: 386 TRTHDSSVVTKKMKSLED----GQTWRKYGQKEIQNSKHSKAYFRCT 514 TRT + + +M+S ED G WRKYGQK ++ + + ++YF+CT Sbjct: 308 TRTSKTQRIILQMESDEDNPNDGYRWRKYGQKVVKGNPNPRSYFKCT 354
>WRK52_ARATH (Q9FH83) Probable WRKY transcription factor 52 (WRKY DNA-binding| protein 52) (Disease resistance protein RRS1) (Resistance to Ralstonia solanacearum 1 protein) (Disease resistance protein SLH1) (SENSITIVE TO LOW HUMIDITY 1 protein) Length = 1288 Score = 41.2 bits (95), Expect = 0.002 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +2 Query: 383 RTRTHDSSVVTK--KMKSLEDGQ--TWRKYGQKEIQNSKHSKAYFRCTRKY 523 + + H S V K + ++++G TWRKYGQK+I S+ + Y+RC K+ Sbjct: 1187 KKKKHSESRVKKVVSIPAIDEGDLWTWRKYGQKDILGSRFPRGYYRCAYKF 1237
>WRK50_ARATH (Q8VWQ5) Probable WRKY transcription factor 50 (WRKY DNA-binding| protein 50) Length = 173 Score = 41.2 bits (95), Expect = 0.002 Identities = 14/32 (43%), Positives = 25/32 (78%) Frame = +2 Query: 419 KMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +++ L+DG WRKYG+K ++NS H + Y++C+ Sbjct: 108 EVEVLDDGFKWRKYGKKMVKNSPHPRNYYKCS 139
>WRK20_ARATH (Q93WV0) Probable WRKY transcription factor 20 (WRKY DNA-binding| protein 20) Length = 557 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/44 (38%), Positives = 29/44 (65%) Frame = +2 Query: 383 RTRTHDSSVVTKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +T +DS T + + +DG WRKYGQK ++ S+ ++Y++CT Sbjct: 195 QTSQNDSRGSTPSILA-DDGYNWRKYGQKHVKGSEFPRSYYKCT 237 Score = 39.7 bits (91), Expect = 0.005 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 L+DG WRKYGQK ++ + + ++Y++CT Sbjct: 380 LDDGYRWRKYGQKVVRGNPNPRSYYKCT 407
>WRK19_ARATH (Q9SZ67) Probable WRKY transcription factor 19 (WRKY DNA-binding| protein 19) Length = 1895 Score = 40.8 bits (94), Expect = 0.002 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 425 KSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 K + DG W+KYGQK+++ SK +Y++CT Sbjct: 465 KQVNDGYNWQKYGQKKVKGSKFPLSYYKCT 494 Score = 34.7 bits (78), Expect = 0.17 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +2 Query: 413 TKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 T ++ +L+DG WRKYGQK ++ + + + F ++ YD Sbjct: 634 TSEVDNLDDGYRWRKYGQKVVKGNPYPR--FSSSKDYD 669
>WRK34_ARATH (O65590) Probable WRKY transcription factor 34 (WRKY DNA-binding| protein 34) Length = 568 Score = 40.4 bits (93), Expect = 0.003 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +2 Query: 413 TKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 T + L+DG WRKYGQK ++ + + ++Y++CT Sbjct: 365 TSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCT 398 Score = 40.4 bits (93), Expect = 0.003 Identities = 13/27 (48%), Positives = 22/27 (81%) Frame = +2 Query: 434 EDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +DG WRKYGQK ++ S++ ++Y++CT Sbjct: 178 DDGYNWRKYGQKLVKGSEYPRSYYKCT 204
>WRK18_ARATH (Q9C5T4) WRKY transcription factor 18 (WRKY DNA-binding protein 18)| (AtWRKY18) Length = 310 Score = 40.0 bits (92), Expect = 0.004 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 386 TRTHDSSVVTKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 T T D+S+ K DG WRKYGQK +++ +AYFRC+ Sbjct: 166 TETSDTSLTVK------DGFQWRKYGQKVTRDNPSPRAYFRCS 202
>WRK62_ARATH (Q9LZV6) Probable WRKY transcription factor 62 (WRKY DNA-binding| protein 62) Length = 263 Score = 39.7 bits (91), Expect = 0.005 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 DG WRKYGQK+I+ S++ ++Y++C D Sbjct: 111 DGFLWRKYGQKQIKESEYQRSYYKCAYTKD 140
>WRK66_ARATH (Q9M8M6) Probable WRKY transcription factor 66 (WRKY DNA-binding| protein 66) Length = 235 Score = 39.7 bits (91), Expect = 0.005 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 DG WRKYGQK I+ S H + Y+RC D Sbjct: 86 DGFIWRKYGQKTIKTSPHQRWYYRCAYAKD 115
>WRK29_ARATH (Q9SUS1) Probable WRKY transcription factor 29 (WRKY DNA-binding| protein 29) Length = 304 Score = 39.3 bits (90), Expect = 0.007 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +2 Query: 416 KKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 K+ L D WRKYGQK I+ S + ++Y+RC+ Sbjct: 128 KEENLLSDAWAWRKYGQKPIKGSPYPRSYYRCS 160
>WRK53_ARATH (Q9SUP6) Probable WRKY transcription factor 53 (WRKY DNA-binding| protein 53) Length = 324 Score = 38.9 bits (89), Expect = 0.009 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = +2 Query: 434 EDGQTWRKYGQKEIQNSKHSKAYFRCTRK 520 +D +WRKYGQK+I +K ++Y+RCT + Sbjct: 158 DDVFSWRKYGQKDILGAKFPRSYYRCTHR 186
>WRKY7_ARATH (Q9STX0) Probable WRKY transcription factor 7 (WRKY DNA-binding| protein 7) Length = 353 Score = 38.5 bits (88), Expect = 0.012 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 410 VTKKMKSL-EDGQTWRKYGQKEIQNSKHSKAYFRCT 514 V+ KM + D +WRKYGQK I+ S H + Y++C+ Sbjct: 272 VSSKMADIPSDEFSWRKYGQKPIKGSPHPRGYYKCS 307
>WRK40_ARATH (Q9SAH7) Probable WRKY transcription factor 40 (WRKY DNA-binding| protein 40) Length = 302 Score = 38.5 bits (88), Expect = 0.012 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +2 Query: 383 RTRTHDSSVVTKKMKSLEDGQTWRKYGQKEIQNSKHSKAYFRC 511 +T D+++V K DG WRKYGQK +++ +AYF+C Sbjct: 135 KTEASDTTLVVK------DGYQWRKYGQKVTRDNPSPRAYFKC 171
>WRK15_ARATH (O22176) Probable WRKY transcription factor 15 (WRKY DNA-binding| protein 15) Length = 317 Score = 38.5 bits (88), Expect = 0.012 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 410 VTKKMKSLE-DGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++ KM + D +WRKYGQK I+ S H + Y++C+ Sbjct: 231 ISAKMSDVPPDDYSWRKYGQKPIKGSPHPRGYYKCS 266
>WRK60_ARATH (Q9SK33) Probable WRKY transcription factor 60 (WRKY DNA-binding| protein 60) Length = 271 Score = 38.1 bits (87), Expect = 0.015 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +++DG WRKYGQK +++ +AYFRC+ Sbjct: 144 TVKDGYQWRKYGQKITRDNPSPRAYFRCS 172
>WRK65_ARATH (Q9LP56) Probable WRKY transcription factor 65 (WRKY DNA-binding| protein 65) Length = 259 Score = 37.7 bits (86), Expect = 0.020 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 12/54 (22%) Frame = +2 Query: 389 RTHDSSVVTKKMKSLE------------DGQTWRKYGQKEIQNSKHSKAYFRCT 514 R+ + VV MK +E D WRKYGQK I+ S + + Y+RC+ Sbjct: 47 RSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCS 100
>WRK17_ARATH (Q9SJA8) Probable WRKY transcription factor 17 (WRKY DNA-binding| protein 17) Length = 321 Score = 37.7 bits (86), Expect = 0.020 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 D +WRKYGQK I+ S H + Y++C+ Sbjct: 244 DEYSWRKYGQKPIKGSPHPRGYYKCS 269
>WRK41_ARATH (Q8H0Y8) Probable WRKY transcription factor 41 (WRKY DNA-binding| protein 41) Length = 313 Score = 37.7 bits (86), Expect = 0.020 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = +2 Query: 434 EDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +D +WRKYGQK+I +K ++Y+RCT Sbjct: 141 DDIFSWRKYGQKDILGAKFPRSYYRCT 167
>WRK74_ARATH (Q93WU6) Probable WRKY transcription factor 74 (WRKY DNA-binding| protein 74) Length = 330 Score = 37.7 bits (86), Expect = 0.020 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 D +WRKYGQK I+ S H + Y++C+ Sbjct: 263 DEYSWRKYGQKPIKGSPHPRGYYKCS 288
>WRK39_ARATH (Q9SR07) Probable WRKY transcription factor 39 (WRKY DNA-binding| protein 39) Length = 330 Score = 37.7 bits (86), Expect = 0.020 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 D +WRKYGQK I+ S H + Y++C+ Sbjct: 263 DEYSWRKYGQKPIKGSPHPRGYYKCS 288
>WRK11_ARATH (Q9SV15) Probable WRKY transcription factor 11 (WRKY DNA-binding| protein 11) Length = 325 Score = 37.7 bits (86), Expect = 0.020 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 D +WRKYGQK I+ S H + Y++C+ Sbjct: 247 DEYSWRKYGQKPIKGSPHPRGYYKCS 272
>WRK51_ARATH (Q93WU9) Probable WRKY transcription factor 51 (WRKY DNA-binding| protein 51) Length = 194 Score = 37.7 bits (86), Expect = 0.020 Identities = 12/32 (37%), Positives = 24/32 (75%) Frame = +2 Query: 419 KMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 K+ ++DG WRKYG+K ++N+ + + Y++C+ Sbjct: 105 KIDVMDDGFKWRKYGKKSVKNNINKRNYYKCS 136
>WRKY9_ARATH (Q9C9F0) Probable WRKY transcription factor 9 (WRKY DNA-binding| protein 9) Length = 374 Score = 37.4 bits (85), Expect = 0.026 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++ DG WRKYGQK + + +AY+RCT Sbjct: 233 TMNDGCQWRKYGQKTAKGNPCPRAYYRCT 261
>WRK42_ARATH (Q9XEC3) Probable WRKY transcription factor 42 (WRKY DNA-binding| protein 42) Length = 528 Score = 37.4 bits (85), Expect = 0.026 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 L DG WRKYGQK + + +AY+RCT Sbjct: 291 LSDGCQWRKYGQKMAKGNPCPRAYYRCT 318
>WRK36_ARATH (Q9CAR4) Probable WRKY transcription factor 36 (WRKY DNA-binding| protein 36) Length = 387 Score = 37.0 bits (84), Expect = 0.034 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 S+ DG WRKYGQK + + +AY+RC+ Sbjct: 201 SINDGCQWRKYGQKTAKTNPLPRAYYRCS 229
>WRK72_ARATH (Q9LXG8) Probable WRKY transcription factor 72 (WRKY DNA-binding| protein 72) Length = 548 Score = 36.6 bits (83), Expect = 0.044 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++ DG WRKYGQK + + +AY+RCT Sbjct: 225 TMNDGCQWRKYGQKIAKGNPCPRAYYRCT 253
>WRK47_ARATH (Q9ZSI7) Probable WRKY transcription factor 47 (WRKY DNA-binding| protein 47) Length = 489 Score = 36.6 bits (83), Expect = 0.044 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++ DG WRKYGQK + + +AY+RCT Sbjct: 237 TVNDGCQWRKYGQKMAKGNPCPRAYYRCT 265
>WRK69_ARATH (Q93WV5) Probable WRKY transcription factor 69 (WRKY DNA-binding| protein 69) Length = 271 Score = 36.6 bits (83), Expect = 0.044 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 D WRKYGQK I+ S + + Y+RC+ Sbjct: 71 DSWAWRKYGQKPIKGSPYPRGYYRCS 96
>WRKY6_ARATH (Q9C519) WRKY transcription factor 6 (WRKY DNA-binding protein 6)| (AtWRKY6) Length = 553 Score = 36.6 bits (83), Expect = 0.044 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 + DG WRKYGQK + + +AY+RCT Sbjct: 311 ISDGCQWRKYGQKMAKGNPCPRAYYRCT 338
>WRK61_ARATH (Q8VWV6) Probable WRKY transcription factor 61 (WRKY DNA-binding| protein 61) Length = 480 Score = 36.6 bits (83), Expect = 0.044 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 ++ DG WRKYGQK + + +AY+RCT Sbjct: 189 TMNDGCQWRKYGQKIAKGNPCPRAYYRCT 217
>WRK31_ARATH (Q93WT0) Probable WRKY transcription factor 31 (WRKY DNA-binding| protein 31) Length = 538 Score = 36.6 bits (83), Expect = 0.044 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 Query: 431 LEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 + DG WRKYGQK + + +AY+RCT Sbjct: 296 ISDGCQWRKYGQKMAKGNPCPRAYYRCT 323
>WRK21_ARATH (O04336) Probable WRKY transcription factor 21 (WRKY DNA-binding| protein 21) Length = 380 Score = 35.8 bits (81), Expect = 0.075 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 D +WRKYGQK I+ S + + Y++C+ Sbjct: 314 DDYSWRKYGQKPIKGSPYPRGYYKCS 339
>WRK22_ARATH (O04609) WRKY transcription factor 22 (WRKY DNA-binding protein 22)| Length = 298 Score = 35.4 bits (80), Expect = 0.098 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 437 DGQTWRKYGQKEIQNSKHSKAYFRCT 514 D WRKYGQK I+ S + + Y+RC+ Sbjct: 129 DVWAWRKYGQKPIKGSPYPRGYYRCS 154
>WRK16_ARATH (Q9FL92) Probable WRKY transcription factor 16 (WRKY DNA-binding| protein 16) Length = 1372 Score = 35.4 bits (80), Expect = 0.098 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +2 Query: 449 WRKYGQKEIQNSKHSKAYFRC 511 WRKYGQK I++S + ++Y+RC Sbjct: 1185 WRKYGQKPIKSSPYPRSYYRC 1205
>WRK35_ARATH (O64747) Probable WRKY transcription factor 35 (WRKY DNA-binding| protein 35) Length = 427 Score = 35.0 bits (79), Expect = 0.13 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 449 WRKYGQKEIQNSKHSKAYFRCT 514 WRKYGQK I+ S + + Y+RC+ Sbjct: 220 WRKYGQKPIKGSPYPRGYYRCS 241
>WRK59_ARATH (Q9SJ09) Probable WRKY transcription factor 59 (WRKY DNA-binding| protein 59) Length = 202 Score = 34.7 bits (78), Expect = 0.17 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 428 SLEDGQTWRKYGQKEIQNSKHSKAYFRCT 514 +L+DG WRKYG+K I S + Y +C+ Sbjct: 107 ALDDGYKWRKYGKKPITGSPFPRHYHKCS 135
>WRK27_ARATH (Q9FLX8) Probable WRKY transcription factor 27 (WRKY DNA-binding| protein 27) Length = 348 Score = 34.3 bits (77), Expect = 0.22 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 449 WRKYGQKEIQNSKHSKAYFRCT 514 WRKYGQK I+ S + + Y+RC+ Sbjct: 170 WRKYGQKPIKGSPYPRNYYRCS 191
>WRK14_ARATH (Q9SA80) Probable WRKY transcription factor 14 (WRKY DNA-binding| protein 14) (AR411) Length = 430 Score = 33.9 bits (76), Expect = 0.29 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 449 WRKYGQKEIQNSKHSKAYFRCT 514 WRKYGQK I+ S + Y+RC+ Sbjct: 222 WRKYGQKPIKGSPFPRGYYRCS 243
>YD89_SCHPO (Q10414) Hypothetical protein C1F3.09 in chromosome I| Length = 561 Score = 30.0 bits (66), Expect = 4.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 419 KMKSLEDGQTWRKYGQKEIQNSKHSKAYFRCTRKYD 526 K+ LED WRK Q E + S+A+ C + YD Sbjct: 524 KILGLEDRVDWRKCVQTEDEEKAESEAFKMCFKPYD 559
>SCW4_YEAST (P53334) Probable family 17 glucosidase SCW4 precursor (EC 3.2.1.-)| (Soluble cell wall protein 4) Length = 386 Score = 28.9 bits (63), Expect = 9.2 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 6/66 (9%) Frame = -2 Query: 183 SCVANSCPLARSSTTCSYGAMAIDRSKHEHVNS------SSLLLHLARTAQHSTAPQSSK 22 + V NS P A +STT S ++A + NS S A + Q S++ Q+S Sbjct: 59 NAVVNSAPAAATSTTSSAASVATAAASSSENNSQVSAAASPASSSAATSTQSSSSSQASS 118 Query: 21 ARAEGE 4 + + GE Sbjct: 119 SSSSGE 124 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,155,722 Number of Sequences: 219361 Number of extensions: 561822 Number of successful extensions: 2560 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 2447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2560 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
