Clone Name | bart37c10 |
---|---|
Clone Library Name | barley_pub |
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2161 Score = 30.0 bits (66), Expect = 3.8 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -1 Query: 304 LPPPRTAWTGCSRPKRR*ILALTPAADP 221 LPPP+TAWT SRP PAA P Sbjct: 383 LPPPKTAWTENSRPSE-----TEPAAPP 405
>PK1L1_MOUSE (Q8R526) Polycystic kidney disease 1-like 1 protein| (Polycystin-1L1) (Fragment) Length = 531 Score = 29.6 bits (65), Expect = 5.0 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -3 Query: 395 HDLEQQPDGRSASEHPSGDLLVPP*NKISRLAAAEDGV 282 HD +PD R S HP+ DLL P ++ R+AA+ V Sbjct: 320 HDSSGRPDSRHPSPHPTSDLL-PWTDQAWRIAASSSAV 356
>RTN2_MOUSE (O70622) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 471 Score = 29.3 bits (64), Expect = 6.5 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Frame = +3 Query: 309 ADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLA---TLFLWSNVCIF 479 ADL+ W++ + SG V G A L ++ + ++++ H +L L +L ++ V Sbjct: 273 ADLLYWKDTRTSGAVFTGLMASLLC--LLHFSIVSVAAHLALLGLCATISLRVYRKVLQA 330 Query: 480 IHKSPPNIP 506 +H+ P Sbjct: 331 VHRGDGTNP 339
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2158 Score = 28.9 bits (63), Expect = 8.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 304 LPPPRTAWTGCSRPKRR*ILALTPAADP 221 LPPP+TAWT +RP TP P Sbjct: 383 LPPPKTAWTENARPSETEPAPPTPKPPP 410
>RTN2_HUMAN (O75298) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 545 Score = 28.9 bits (63), Expect = 8.5 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = +3 Query: 297 GGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLA---TLFLWSN 467 G K ADL+ W++ + SG V G L ++ + ++++ H +L L +L ++ Sbjct: 342 GSKVADLLYWKDTRTSGVVFTGLMVSLLC--LLHFSIVSVAAHLALLLLCGTISLRVYRK 399 Query: 468 VCIFIHK 488 V +H+ Sbjct: 400 VLQAVHR 406 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,296,506 Number of Sequences: 219361 Number of extensions: 681869 Number of successful extensions: 2412 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2410 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)