Clone Name | bart35d12 |
---|---|
Clone Library Name | barley_pub |
>SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4| Length = 489 Score = 32.0 bits (71), Expect = 0.97 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 382 PSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSR 489 P++PA R S RSRS++P+ + + +PSRSR Sbjct: 447 PNVPAESRSRSKSASKTRSRSKSPSRSASRSPSRSR 482
>HCN4_MOUSE (O70507) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 (Brain cyclic nucleotide gated channel 3) (BCNG-3) Length = 1186 Score = 30.8 bits (68), Expect = 2.2 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +1 Query: 361 PPSTSCPPSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSRFMA 498 PPS+ P S P + PG LS + + T P P R FMA Sbjct: 948 PPSSRSPSSSPGQLGQPPGELSLGLAAGPSSTPETPPRPERPSFMA 993
>RECQ4_HUMAN (O94761) ATP-dependent DNA helicase Q4 (EC 3.6.1.-) (RecQ| protein-like 4) (RecQ4) (RTS) Length = 1208 Score = 29.6 bits (65), Expect = 4.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 385 SLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSR 489 SLPA ++P W +R T + PTP RSR Sbjct: 64 SLPAAAEEAPEPRCWGPHLNRAATKSPQPTPGRSR 98
>HCN4_RAT (Q9JKA7) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 Length = 1198 Score = 29.3 bits (64), Expect = 6.3 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 361 PPSTSCPPSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSRFMA 498 PPS+ P S P + PG LS + T P P R FMA Sbjct: 961 PPSSRSPSSSPGQLGQPPGELSPGLAAGPPSTPETPPRPERPSFMA 1006
>MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemotaxis protein)| Length = 657 Score = 28.9 bits (63), Expect = 8.2 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -3 Query: 190 TSAAASD*SSWVRRTALGGPWSSEVVSKTR 101 T+AA + ++ VRRTA G +S+VVS TR Sbjct: 386 TAAALDELTATVRRTAAGARQASDVVSTTR 415
>IF2_SYNY3 (P72689) Translation initiation factor IF-2| Length = 1001 Score = 28.9 bits (63), Expect = 8.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 361 PPSTSCPPSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSRSR 489 PPS PP+ PA K L+ R+ +P P P++ + Sbjct: 162 PPSKPAPPTPPAKKAAPAPRLAGPPGRTASPNKTAVPAPAKPK 204 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,128,197 Number of Sequences: 219361 Number of extensions: 714131 Number of successful extensions: 2996 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2980 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)