| Clone Name | bart35d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PVG3_SCHPO (Q9USX0) Beta-1,3-galactosyltransferase pvg3 (EC 2.4.... | 39 | 0.010 | 2 | YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'regio... | 29 | 7.7 | 3 | ZO1_HUMAN (Q07157) Tight junction protein ZO-1 (Zonula occludens... | 29 | 10.0 |
|---|
>PVG3_SCHPO (Q9USX0) Beta-1,3-galactosyltransferase pvg3 (EC 2.4.1.134)| (Pyruvylated Gal-beta-1,3-epitope synthesis protein 3) (PvGal synthesis protein 3) Length = 378 Score = 38.9 bits (89), Expect = 0.010 Identities = 25/83 (30%), Positives = 39/83 (46%) Frame = +2 Query: 257 ILVGVHTMPKKHSRRHLIRMAYALQQTAALRGAARVDVRFALCARPMPPEHAAFVALERR 436 + +G+ + K RR+ +R Y + VDVRF L P + A + E+R Sbjct: 66 LYLGIFSQAKNVDRRNFLRTDYN-EYIKEFAVNDTVDVRFIL-GLPENEQELATIREEQR 123 Query: 437 AYGDVLLFNCTENAEDGKTYTYF 505 YGD+ + EN + GK+ YF Sbjct: 124 TYGDLAVLPIPENVDAGKSIVYF 146
>YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'region of gyrA and| gyrB (ORF 3) Length = 437 Score = 29.3 bits (64), Expect = 7.7 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = -2 Query: 433 ALQRHERGV-----LGRHRPRAEREPDVYPRGAPERRRLLQR 323 AL+R +R V GRH PR R P GAP RR LL+R Sbjct: 68 ALRRADRRVEHVPLRGRH-PRVRRVPQRDQDGAPRRRHLLRR 108
>ZO1_HUMAN (Q07157) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1748 Score = 28.9 bits (63), Expect = 10.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 403 GRHRPRAEREPDVYPRGAPERRRLLQRVRHPDQVPP 296 GR RP A+ P P+ A ++ Q R +QVPP Sbjct: 1169 GRLRPEAQPHPSAGPKPAESKQYFEQYSRSYEQVPP 1204 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,108,995 Number of Sequences: 219361 Number of extensions: 696265 Number of successful extensions: 2043 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2043 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)