Clone Name | bart34b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DCD_NEIMB (P63904) Deoxycytidine triphosphate deaminase (EC 3.5.... | 29 | 4.3 | 2 | DCD_NEIMA (P63903) Deoxycytidine triphosphate deaminase (EC 3.5.... | 29 | 4.3 | 3 | FA10_RABIT (O19045) Coagulation factor X precursor (EC 3.4.21.6)... | 28 | 7.3 |
---|
>DCD_NEIMB (P63904) Deoxycytidine triphosphate deaminase (EC 3.5.4.13) (dCTP| deaminase) Length = 188 Score = 28.9 bits (63), Expect = 4.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 103 QRRPEPFGLVDVREPGKIDEGDGLRKVVGG 14 +R E FG++D EP +I E DG R + G Sbjct: 10 RRMSEEFGMIDPFEPNQIKEADGKRIISYG 39
>DCD_NEIMA (P63903) Deoxycytidine triphosphate deaminase (EC 3.5.4.13) (dCTP| deaminase) Length = 188 Score = 28.9 bits (63), Expect = 4.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 103 QRRPEPFGLVDVREPGKIDEGDGLRKVVGG 14 +R E FG++D EP +I E DG R + G Sbjct: 10 RRMSEEFGMIDPFEPNQIKEADGKRIISYG 39
>FA10_RABIT (O19045) Coagulation factor X precursor (EC 3.4.21.6) (Stuart| factor) [Contains: Factor X light chain; Factor X heavy chain; Activated factor Xa heavy chain] Length = 490 Score = 28.1 bits (61), Expect = 7.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 88 PFGLVDVREPGKIDEGDGLRKVVGGQ 11 PF L+D EP D+ L ++VGGQ Sbjct: 212 PFNLLDSPEPPPEDDSSSLVRIVGGQ 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,105,425 Number of Sequences: 219361 Number of extensions: 120540 Number of successful extensions: 416 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 80,573,946 effective HSP length: 9 effective length of database: 78,599,697 effective search space used: 1886392728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)