Clone Name | bart33a09 |
---|---|
Clone Library Name | barley_pub |
>HPPD_HORVU (O48604) 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)| (4HPPD) (HPD) (HPPDase) (4-hydroxyphenylpyruvic acid oxidase) Length = 434 Score = 93.6 bits (231), Expect = 1e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 VTPEHARPHRMVRFNPRSDRFHTLSFHHVEFWCADAASAAG 125 VTPEHARPHRMVRFNPRSDRFHTLSFHHVEFWCADAASAAG Sbjct: 17 VTPEHARPHRMVRFNPRSDRFHTLSFHHVEFWCADAASAAG 57
>HPPD_ARATH (P93836) 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)| (4HPPD) (HPD) (HPPDase) (4-hydroxyphenylpyruvic acid oxidase) Length = 445 Score = 46.2 bits (108), Expect = 3e-05 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 30 RMVRFNPRSDRFHTLSFHHVEFWCADAASAA 122 + VR NP+SD+F FHH+EFWC DA + A Sbjct: 31 KFVRKNPKSDKFKVKRFHHIEFWCGDATNVA 61
>HPPD_DAUCA (O23920) 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)| (4HPPD) (HPD) (HPPDase) (4-hydroxyphenylpyruvic acid oxidase) Length = 442 Score = 43.9 bits (102), Expect = 1e-04 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 Query: 27 HRMVRFNPRSDRFHTLSFHHVEFWCADAASAA 122 + VR NP+SD F FHH+EFWC DA + + Sbjct: 29 NNFVRANPKSDHFAVKRFHHIEFWCGDATNTS 60
>HPPD_SOLSC (Q9ARF9) 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)| (4HPPD) (HPD) (HPPDase) (4-hydroxyphenylpyruvic acid oxidase) Length = 436 Score = 42.4 bits (98), Expect = 4e-04 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = +3 Query: 36 VRFNPRSDRFHTLSFHHVEFWCADAASAA 122 VR NP SD F FHHVEFWC DA + + Sbjct: 25 VRSNPMSDHFPVHRFHHVEFWCGDATNTS 53
>UGGG_SCHPO (Q09140) UDP-glucose:glycoprotein glucosyltransferase precursor (EC| 2.4.1.-) (UDP--Glc:glycoprotein glucosyltransferase) (UGT) Length = 1448 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 124 PAAEAASAHQNSTWWKESVWKRSLRGLK 41 P ++ + +WK+ WK+ LRGLK Sbjct: 1285 PMCDSREEMEGFRFWKKGYWKKFLRGLK 1312
>HPPD_BRARE (Q6TGZ5) 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)| (4HPPD) (HPD) (HPPDase) (4-hydroxyphenylpyruvic acid oxidase) Length = 397 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 51 RSDRFHTLSFHHVEFWCADAASAA 122 + +R L+FHH++FW +A AA Sbjct: 10 KPERGKFLNFHHIKFWVGNAKQAA 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,356,380 Number of Sequences: 219361 Number of extensions: 128216 Number of successful extensions: 445 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 80,573,946 effective HSP length: 17 effective length of database: 76,844,809 effective search space used: 1844275416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)