Clone Name | bart32f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PHOSP_NDVB (P24698) Phosphoprotein (Protein P) | 30 | 3.7 | 2 | Y147_HAEIN (P44543) Putative TRAP transporter permease protein H... | 29 | 8.3 |
---|
>PHOSP_NDVB (P24698) Phosphoprotein (Protein P)| Length = 395 Score = 30.4 bits (67), Expect = 3.7 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 328 AWTNHGQQEPPAQQN-PRYFTRNNDQPSPPRSS 233 AW HG +PPA Q+ P R++ QPS P + Sbjct: 50 AWEKHGSIQPPASQDTPDRQDRSDKQPSTPEQA 82
>Y147_HAEIN (P44543) Putative TRAP transporter permease protein HI0147| Length = 633 Score = 29.3 bits (64), Expect = 8.3 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 280 WGFAALEVLAGHGLSRHAEAQSLSFMKIATHLRRCCFLQSFSVVFLYYFY 429 W FAAL V+A + R +AQ+L+F ++L F+ S ++F F+ Sbjct: 140 WIFAALPVVAILMMFRFIQAQTLNFKTGKSYLPATFFIISAVILFAILFF 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,678,041 Number of Sequences: 219361 Number of extensions: 907182 Number of successful extensions: 2516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2512 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)