Clone Name | bart32f05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KIF4A_HUMAN (O95239) Chromosome-associated kinesin KIF4A (Chromo... | 29 | 4.1 | 2 | MISS_MOUSE (Q9D7G9) MAPK-interacting and spindle-stabilizing pro... | 28 | 9.2 |
---|
>KIF4A_HUMAN (O95239) Chromosome-associated kinesin KIF4A (Chromokinesin)| Length = 1232 Score = 28.9 bits (63), Expect = 4.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 128 TAAAAGRYCSGSTYWLGGSFTPAPTSSCTIGGTSRIL 18 T A G+ SG TY +GG++T + T+G R++ Sbjct: 83 TVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVI 119
>MISS_MOUSE (Q9D7G9) MAPK-interacting and spindle-stabilizing protein| (Mitogen-activated protein kinase 1-interacting protein 1) Length = 263 Score = 27.7 bits (60), Expect = 9.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 34 PPIVQELVGAGVKEPPSQYVLPEQYRPA 117 PP+ V G EPP+QY PE P+ Sbjct: 111 PPVAWVTVPPGAWEPPAQYPTPEASYPS 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,570,120 Number of Sequences: 219361 Number of extensions: 303003 Number of successful extensions: 987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 80,573,946 effective HSP length: 18 effective length of database: 76,625,448 effective search space used: 1839010752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)