Clone Name | bart30g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RELB_CHICK (P51509) Transcription factor RelB homolog | 29 | 8.4 |
---|
>RELB_CHICK (P51509) Transcription factor RelB homolog| Length = 549 Score = 29.3 bits (64), Expect = 8.4 Identities = 20/66 (30%), Positives = 23/66 (34%) Frame = +1 Query: 379 PPSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTPSXXXXXXXXXXXXXXXXXC*GGSATAS 558 PPS P + W RS RTP +TPTP GG T+ Sbjct: 483 PPSTP--------QILWGRSYFRTPPPTETPTPPTASWGPICSQGTSEG----GGGRTSP 530 Query: 559 ASTPPP 576 PPP Sbjct: 531 RYRPPP 536 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,159,537 Number of Sequences: 219361 Number of extensions: 894169 Number of successful extensions: 3242 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3240 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4872342800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)