Clone Name | bart29h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DDFL1_MOUSE (Q5U464) Development and differentiation enhancing f... | 31 | 1.9 | 2 | ZN509_HUMAN (Q6ZSB9) Zinc finger protein 509 | 30 | 3.2 | 3 | CATA_ACIGB (Q43984) Catechol 1,2-dioxygenase (EC 1.13.11.1) | 29 | 9.3 |
---|
>DDFL1_MOUSE (Q5U464) Development and differentiation enhancing factor-like 1| Length = 904 Score = 31.2 bits (69), Expect = 1.9 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 155 SGAGQVVTHPHVRHALEAEGGSKLTSTRHSL 63 SG G V T H R A+EA G S L+ H L Sbjct: 65 SGLGHVETEEHYREAVEALGNSHLSQNSHEL 95
>ZN509_HUMAN (Q6ZSB9) Zinc finger protein 509| Length = 765 Score = 30.4 bits (67), Expect = 3.2 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 1 TTSCHRPQQLHSSKQRRQGSLSECLVLV 84 T SCH QQLH +QR QG L +C+++V Sbjct: 6 THSCHLLQQLH--EQRIQGLLCDCMLVV 31
>CATA_ACIGB (Q43984) Catechol 1,2-dioxygenase (EC 1.13.11.1)| Length = 305 Score = 28.9 bits (63), Expect = 9.3 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 7/46 (15%) Frame = -1 Query: 461 RAPERDHRAGRAGG-------PLLVPAAVEQVAVLPLEDGAEDGAV 345 RA E D +AG GG PL V A E V ++DG+E V Sbjct: 85 RADEADAKAGITGGTPRTIEGPLYVAGAPESVGFARMDDGSESAHV 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,765,770 Number of Sequences: 219361 Number of extensions: 999051 Number of successful extensions: 3439 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3439 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)