Clone Name | bart29h01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COX1_PLACH (O99255) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 33 | 0.17 | 2 | ECM21_YEAST (P38167) Extracellular matrix protein 21 | 28 | 5.4 | 3 | IKI3_YEAST (Q06706) Elongator complex protein 1 (Gamma-toxin tar... | 28 | 5.4 |
---|
>COX1_PLACH (O99255) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 476 Score = 33.5 bits (75), Expect = 0.17 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = -2 Query: 137 WTWQPPL-----SLSPPLMDVFPLGFLVKEISWVVWRLGASSMVL 18 WTW PPL SLSP +DV +G LV I+ ++ L + V+ Sbjct: 131 WTWYPPLSTSLMSLSPVAVDVIVIGLLVSGIASIMSSLNFLTTVM 175
>ECM21_YEAST (P38167) Extracellular matrix protein 21| Length = 1117 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 6 HKASKHHRASSKPPYDPRNLFH 71 HK SK H + KP YDP+ FH Sbjct: 783 HKGSKSHEENEKPVYDPK--FH 802
>IKI3_YEAST (Q06706) Elongator complex protein 1 (Gamma-toxin target 1) (Protein| IKI3) Length = 1349 Score = 28.5 bits (62), Expect = 5.4 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +1 Query: 7 TRQASTIELAPSLHTTQEISFTRKPRGKTSINGGESESG 123 T QA + +APS +TQE FTR GKT GG +++G Sbjct: 1191 TEQADDVSVAPSETSTQESFFTRY-TGKT---GGTAKTG 1225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.308 0.123 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,091,748 Number of Sequences: 219361 Number of extensions: 314230 Number of successful extensions: 800 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)