| Clone Name | bart29f06 |
|---|---|
| Clone Library Name | barley_pub |
>NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.-)| (Nepenthesin-I) Length = 437 Score = 81.6 bits (200), Expect = 9e-16 Identities = 39/105 (37%), Positives = 58/105 (55%) Frame = +3 Query: 153 RLEGLRVALTHVDAHGNYTKLQXXXXXXXXXXXXXXXXXXXTTGVPVMSSKAVAPALQVP 332 ++ G ++ L HVD+ N TK Q G ++ Sbjct: 37 KVTGFQIMLEHVDSGKNLTKFQLLERAIERGSRRLQRLEAMLNG---------PSGVETS 87 Query: 333 VHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFTR 467 V+AG+GE+LM++SIGTPA ++AI+DTGSDL+WTQC+PC +CF + Sbjct: 88 VYAGDGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQ 132
>NEP2_NEPGR (Q766C2) Aspartic proteinase nepenthesin-2 precursor (EC 3.4.23.-)| (Nepenthesin-II) Length = 438 Score = 79.7 bits (195), Expect = 3e-15 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 2/129 (1%) Frame = +3 Query: 87 VATAMVA--SCATGGLTATSSQLGRLEGLRVALTHVDAHGNYTKLQXXXXXXXXXXXXXX 260 + +A+VA S + G Q GLRV L VD+ N TK + Sbjct: 14 IVSAIVAPTSSTSRGTLLHHGQKRPQPGLRVDLEQVDSGKNLTKYELIKRAIKRGERRMR 73 Query: 261 XXXXXTTGVPVMSSKAVAPALQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQC 440 + + SS + + PV+AG+GE+LM+++IGTP +++AI+DTGSDL+WTQC Sbjct: 74 -----SINAMLQSSSGI----ETPVYAGDGEYLMNVAIGTPDSSFSAIMDTGSDLIWTQC 124 Query: 441 KPCVECFTR 467 +PC +CF++ Sbjct: 125 EPCTQCFSQ 133
>NEP1_NEPDI (P69476) Aspartic proteinase nepenthesin-1 (EC 3.4.23.-)| (Nepenthesin-I) (Fragments) Length = 164 Score = 62.0 bits (149), Expect = 7e-10 Identities = 26/49 (53%), Positives = 39/49 (79%) Frame = +3 Query: 321 LQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFTR 467 ++ V+AG+GE+LM +SIGTPA ++AI+DTGSDL+WTQ +P + F + Sbjct: 6 VETTVYAGDGEYLMXLSIGTPAQPFSAIMDTGSDLIWTQXQPXTQXFXQ 54
>ASP1_ORYSA (Q6YNY7) Aspartic proteinase Asp1 precursor (EC 3.4.23.-) (OsAsp1)| (Nucellin-like protein) Length = 410 Score = 42.0 bits (97), Expect = 8e-04 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 348 GEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCK-PCVEC 458 G F + M+I PA Y IDTGS L W QC PC+ C Sbjct: 36 GHFFVTMNISDPAKPYFLDIDTGSTLTWLQCDYPCINC 73
>NEP2_NEPDI (P69477) Aspartic proteinase nepenthesin-2 (EC 3.4.23.-)| (Nepenthesin-II) (Fragments) Length = 178 Score = 39.7 bits (91), Expect = 0.004 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +3 Query: 321 LQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFTR 467 ++ P +AG+GE+LM DL+WTQC+PC +CF++ Sbjct: 5 VEPPYYAGDGEYLM------------------VDLIWTQCEPCTQCFSQ 35
>CARPV_CANAL (P10977) Vacuolar aspartic protease precursor (EC 3.4.23.-)| (Aspartate protease) (ACP) Length = 419 Score = 35.0 bits (79), Expect = 0.095 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC--VECF 461 N ++ ++ IGTP + I+DTGS +W + C + CF Sbjct: 101 NAQYFTEIQIGTPGQPFKVILDTGSSNLWVPSQDCTSLACF 141
>CARP_YEAST (P07267) Saccharopepsin precursor (EC 3.4.23.25) (Aspartate| protease) (Proteinase A) (Proteinase YSCA) Length = 405 Score = 34.7 bits (78), Expect = 0.12 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC--VECF 461 N ++ D+++GTP + I+DTGS +W C + CF Sbjct: 88 NAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACF 128
>CARP_NEUCR (Q01294) Vacuolar protease A precursor (EC 3.4.23.-)| Length = 396 Score = 34.3 bits (77), Expect = 0.16 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC--VECF 461 N ++ +++IGTP + ++DTGS +W C + C+ Sbjct: 82 NAQYFSEITIGTPPQTFKVVLDTGSSNLWVPSSQCGSIACY 122
>CATD_MOUSE (P18242) Cathepsin D precursor (EC 3.4.23.5)| Length = 410 Score = 32.7 bits (73), Expect = 0.47 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 297 SSKAVAPALQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 S K P ++ + + ++ D+ IGTP + + DTGS +W P + C Sbjct: 60 SPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWV---PSIHC 110
>ASP3_CAEEL (P55956) Aspartic protease 3 precursor (EC 3.4.23.-)| Length = 398 Score = 32.7 bits (73), Expect = 0.47 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 N ++ ++IGTP + + DTGS +W C C Sbjct: 66 NAQYYGPVTIGTPPQNFQVLFDTGSSNLWVPCANC 100
>ASPR1_ORYSA (Q42456) Aspartic proteinase oryzasin-1 precursor (EC 3.4.23.-)| Length = 509 Score = 32.7 bits (73), Expect = 0.47 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC---VECF 461 N ++ ++ +GTP + I DTGS +W C + CF Sbjct: 82 NAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACF 123
>RENI_CALJA (Q9TSZ1) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 400 Score = 32.3 bits (72), Expect = 0.62 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 ++ ++ IGTP + + DTGS VW C +T Sbjct: 79 QYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYT 116
>RENI_PANTR (P60016) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 32.3 bits (72), Expect = 0.62 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 ++ ++ IGTP + + DTGS VW C +T Sbjct: 85 QYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYT 122
>RENI_MACMU (Q6DLW5) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 32.3 bits (72), Expect = 0.62 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 ++ ++ IGTP + + DTGS VW C +T Sbjct: 85 QYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYT 122
>RENI_MACFA (Q6DLS0) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 32.3 bits (72), Expect = 0.62 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 ++ ++ IGTP + + DTGS VW C +T Sbjct: 85 QYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYT 122
>RENI_HUMAN (P00797) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 32.3 bits (72), Expect = 0.62 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 ++ ++ IGTP + + DTGS VW C +T Sbjct: 85 QYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYT 122
>PAG2_BOVIN (Q28057) Pregnancy-associated glycoprotein 2 precursor (EC| 3.4.23.-) (PAG 2) Length = 376 Score = 32.3 bits (72), Expect = 0.62 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 354 FLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVE--CFT 464 ++ +++IGTP + + DTGS +W C C C+T Sbjct: 68 YVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYT 106
>PTFAX_RHOCA (P23388) Multiphosphoryl transfer protein (MTP) [Includes:| Phosphoenolpyruvate-protein phosphotransferase (EC 2.7.3.9) (Phosphotransferase system enzyme I); Phosphocarrier protein HPr (Protein H); Fructose-specific phosphotransferase enzyme I Length = 827 Score = 32.0 bits (71), Expect = 0.80 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +3 Query: 282 GVPVMSSKAVAPALQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLV 428 G P + +A AL +P AG G L+D++ GTP ++D G+ ++ Sbjct: 452 GGPTSHTSIIARALDIPAVAGVGPRLLDLATGTP-----VLLDGGAGVI 495
>CARP_IRPLA (P17576) Polyporopepsin (EC 3.4.23.29) (Aspartic proteinase)| Length = 340 Score = 32.0 bits (71), Expect = 0.80 Identities = 9/27 (33%), Positives = 20/27 (74%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVW 431 ++++++ +G+PA Y+ ++DTGS W Sbjct: 13 DYVVNVGVGSPATTYSLLVDTGSSNTW 39
>PQIA_SHIFL (P0AFM1) Paraquat-inducible protein A| Length = 417 Score = 31.6 bits (70), Expect = 1.0 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = -3 Query: 202 LPCASTCV---RATRRPSRRPSWDDVAVRPPVAQ-LATIAVATKRSNRSCTCAPILFAFD 35 LP CV RA + RR WDD+A P + Q L ++ RSC+C + D Sbjct: 175 LPWCLFCVLQLRAFQCVDRRWLWDDIAPMPELRQPLKPGVTGIRQGLRSCSCCTAILPAD 234 Query: 34 E 32 E Sbjct: 235 E 235
>PQIA_ECOLI (P0AFL9) Paraquat-inducible protein A| Length = 417 Score = 31.6 bits (70), Expect = 1.0 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = -3 Query: 202 LPCASTCV---RATRRPSRRPSWDDVAVRPPVAQ-LATIAVATKRSNRSCTCAPILFAFD 35 LP CV RA + RR WDD+A P + Q L ++ RSC+C + D Sbjct: 175 LPWCLFCVLQLRAFQCVDRRWLWDDIAPMPELRQPLKPGVTGIRQGLRSCSCCTAILPAD 234 Query: 34 E 32 E Sbjct: 235 E 235
>PQIA_ECOL6 (P0AFM0) Paraquat-inducible protein A| Length = 417 Score = 31.6 bits (70), Expect = 1.0 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = -3 Query: 202 LPCASTCV---RATRRPSRRPSWDDVAVRPPVAQ-LATIAVATKRSNRSCTCAPILFAFD 35 LP CV RA + RR WDD+A P + Q L ++ RSC+C + D Sbjct: 175 LPWCLFCVLQLRAFQCVDRRWLWDDIAPMPELRQPLKPGVTGIRQGLRSCSCCTAILPAD 234 Query: 34 E 32 E Sbjct: 235 E 235
>CATEA_XENLA (Q805F3) Cathepsin E-A precursor (EC 3.4.23.34)| Length = 397 Score = 31.6 bits (70), Expect = 1.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCV 452 E+ ++S+GTP + I DTGS +W C+ Sbjct: 73 EYFGEISVGTPPQNFTVIFDTGSSNLWVPSVYCI 106
>PEPA4_MACFU (P27678) Pepsin A-4 precursor (EC 3.4.23.1) (Pepsin I/II)| Length = 388 Score = 31.6 bits (70), Expect = 1.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 E+ + IGTPA + + DTGS +W P V C++ Sbjct: 75 EYFGTIGIGTPAQNFTVVFDTGSSNLWV---PSVYCYS 109
>ASPR_HORVU (P42210) Phytepsin precursor (EC 3.4.23.40) (Aspartic proteinase)| [Contains: Phytepsin 32 kDa subunit; Phytepsin 29 kDa subunit; Phytepsin 16 kDa subunit; Phytepsin 11 kDa subunit] Length = 508 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 N ++ ++ +GTP + I DTGS +W C Sbjct: 81 NAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKC 115
>CARP_RHIMI (P00799) Mucorpepsin precursor (EC 3.4.23.23) (Mucor rennin)| Length = 430 Score = 31.6 bits (70), Expect = 1.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVE 455 E+ + +SIGTP + + DTGS W K C + Sbjct: 88 EYAIPVSIGTPGQDFLLLFDTGSSDTWVPHKGCTK 122
>PEPA1_RABIT (P28712) Pepsin II-1 precursor (EC 3.4.23.1) (Pepsin A)| Length = 387 Score = 31.6 bits (70), Expect = 1.0 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC--VECF 461 + E+ +SIGTP + I DTGS +W C + CF Sbjct: 72 DAEYFGTISIGTPPQEFTVIFDTGSSNLWVPSTYCSSLACF 112
>ASPR_CUCPE (O04057) Aspartic proteinase precursor (EC 3.4.23.-)| Length = 513 Score = 31.2 bits (69), Expect = 1.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCK 443 + ++ +++IGTP + I DTGS +W C+ Sbjct: 87 DAQYYGEIAIGTPPQKFTVIFDTGSSNLWVLCE 119
>CARP_RHIPU (P09177) Mucorpepsin precursor (EC 3.4.23.23) (Mucor rennin)| Length = 427 Score = 30.8 bits (68), Expect = 1.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 E+ + +SIGTP + + DTGS W K C Sbjct: 85 EYAIPVSIGTPGQDFYLLFDTGSSDTWVPHKGC 117
>CATEB_XENLA (Q805F2) Cathepsin E-B precursor (EC 3.4.23.34)| Length = 397 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCV 452 ++ ++SIGTP + I DTGS +W C+ Sbjct: 73 QYFGEISIGTPPQNFTVIFDTGSSNLWVPSVYCI 106
>CARP_SYNRA (P81214) Syncephapepsin precursor (EC 3.4.23.-)| Length = 395 Score = 30.8 bits (68), Expect = 1.8 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +S+GTPA + DTGS +W C C Sbjct: 88 EYYATVSVGTPAQSIKLDFDTGSSDLWFSSTLCTSC 123
>PEP2B_GADMO (P56272) Pepsin IIB (EC 3.4.23.-)| Length = 324 Score = 30.8 bits (68), Expect = 1.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 E+ +SIGTP ++ I DTGS +W C Sbjct: 13 EYYGVISIGTPPESFKVIFDTGSSNLWVSSSHC 45
>ASPP_AEDAE (Q03168) Lysosomal aspartic protease precursor (EC 3.4.23.-)| Length = 387 Score = 30.8 bits (68), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 366 MSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 ++IGTP ++ + DTGS +W K C Sbjct: 72 ITIGTPPQSFKVVFDTGSSNLWVPSKEC 99
>RENI2_MOUSE (P00796) Renin-2 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Submandibular gland renin) [Contains: Renin-2 heavy chain; Renin-2 light chain] Length = 401 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 N ++ ++ IGTP + I DTGS +W C Sbjct: 80 NSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKC 114
>RENI_RAT (P08424) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 402 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 ++ ++ IGTP+ + I DTGS +W C +T Sbjct: 83 QYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYT 120
>CATE_RANCA (Q800A0) Cathepsin E precursor (EC 3.4.23.34)| Length = 397 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +SIGTP + I DTGS +W P + C Sbjct: 73 EYFGQISIGTPPQQFTVIFDTGSSNLWV---PSIYC 105
>PEPA_PIG (P00791) Pepsin A precursor (EC 3.4.23.1)| Length = 386 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + I DTGS +W P V C Sbjct: 72 EYFGTIGIGTPAQDFTVIFDTGSSNLWV---PSVYC 104
>PEPA_MACMU (P11489) Pepsin A precursor (EC 3.4.23.1)| Length = 388 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + I DTGS +W P V C Sbjct: 75 EYFGTIGIGTPAQDFTVIFDTGSSNLWV---PSVYC 107
>PEPA2_MACFU (P27677) Pepsin A-2/A-3 precursor (EC 3.4.23.1) (Pepsin| III-2/III-1) Length = 388 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + I DTGS +W P V C Sbjct: 75 EYFGTIGIGTPAQDFTVIFDTGSSNLWV---PSVYC 107
>PEPA1_MACFU (P03954) Pepsin A-1 precursor (EC 3.4.23.1) (Pepsin III-3)| Length = 388 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + I DTGS +W P V C Sbjct: 75 EYFGTIGIGTPAQDFTVIFDTGSSNLWV---PSVYC 107
>CYPR1_CYNCA (P40782) Cyprosin precursor (EC 3.4.23.-) (Fragment)| Length = 473 Score = 30.4 bits (67), Expect = 2.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 + ++ ++ IGTP + I DTGS +W C Sbjct: 48 DAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKC 82
>PEPA_CALJA (Q9N2D4) Pepsin A precursor (EC 3.4.23.1)| Length = 387 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + I DTGS +W P + C Sbjct: 74 EYFGTIGIGTPAQEFTVIFDTGSSNLWV---PSIYC 106
>PEPA4_RABIT (P28713) Pepsin II-4 precursor (EC 3.4.23.1) (Pepsin A)| Length = 387 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 + E+ +SIGTP + I DTGS +W C Sbjct: 72 DAEYFGTISIGTPPQDFTVIFDTGSSNLWVPSTYC 106
>PEPA3_RABIT (P27822) Pepsin-3 precursor (EC 3.4.23.1) (Pepsin III) (Pepsin A)| Length = 387 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + I DTGS +W P V C Sbjct: 74 EYFGTIGIGTPAQDFTVIFDTGSSNLWV---PSVYC 106
>PEPA2_RABIT (P27821) Pepsin II-2/3 precursor (EC 3.4.23.1) (Pepsin A)| Length = 387 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 + E+ +SIGTP + I DTGS +W C Sbjct: 72 DAEYFGTISIGTPPQDFTVIFDTGSSNLWVPSTYC 106
>CARP3_RHINI (Q03699) Rhizopuspepsin-3 precursor (EC 3.4.23.21) (Aspartate| protease) Length = 391 Score = 30.4 bits (67), Expect = 2.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ ++++GTP V DTGS +W C C Sbjct: 83 EYYGEVTVGTPGVTLKLDFDTGSSDLWFASSLCTNC 118
>RENI1_MOUSE (P06281) Renin-1 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Kidney renin) Length = 402 Score = 30.0 bits (66), Expect = 3.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 N ++ ++ IGTP + I DTGS +W C Sbjct: 81 NTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKC 115
>PEPE_CHICK (P16476) Embryonic pepsinogen precursor (EC 3.4.23.-)| Length = 383 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +SIGTP + + DTGS +W P V C Sbjct: 75 EYYGTISIGTPPQDFTVVFDTGSSNLWV---PSVSC 107
>CATE_MOUSE (P70269) Cathepsin E precursor (EC 3.4.23.34)| Length = 397 Score = 30.0 bits (66), Expect = 3.1 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +SIGTP + I DTGS +W P V C Sbjct: 78 EYFGTISIGTPPQNFTVIFDTGSSNLWV---PSVYC 110
>RENI_SHEEP (P52115) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 400 Score = 30.0 bits (66), Expect = 3.1 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFT 464 ++ ++ IGTP + I DTGS +W C +T Sbjct: 79 QYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSPLYT 116
>PEPA_HUMAN (P00790) Pepsin A precursor (EC 3.4.23.1)| Length = 388 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + + DTGS +W P V C Sbjct: 75 EYFGTIGIGTPAQDFTVVFDTGSSNLWV---PSVYC 107
>G156_PARPR (P13837) G surface protein, allelic form 156 precursor| Length = 2715 Score = 30.0 bits (66), Expect = 3.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 378 TPAVAYAAIIDTGSDLVWTQCKPCVEC 458 TP V YAA DT ++ + KPC +C Sbjct: 61 TPTVTYAAYCDTFAETDCPKAKPCTDC 87
>PEPA_BOVIN (P00792) Pepsin A precursor (EC 3.4.23.1)| Length = 372 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTPA + I DTGS +W P + C Sbjct: 59 EYFGTIGIGTPAQDFTVIFDTGSSNLWV---PSIYC 91
>G168_PARPR (P17053) G surface protein, allelic form 168 precursor| Length = 2704 Score = 30.0 bits (66), Expect = 3.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 378 TPAVAYAAIIDTGSDLVWTQCKPCVEC 458 TP V YAA DT ++ + KPC +C Sbjct: 61 TPTVTYAAYCDTFAETDCPKAKPCTDC 87
>PEPA_SORUN (Q9GMY8) Pepsin A precursor (EC 3.4.23.1)| Length = 387 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +SIGTP + I DTGS +W P + C Sbjct: 74 EYFGTISIGTPPQEFTVIFDTGSSNLWV---PSIYC 106
>PEPC_RHIFE (Q9GMY3) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 389 Score = 29.6 bits (65), Expect = 4.0 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 330 PVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFTR 467 P+ + + ++SIGTP + + DTGS +W P V C T+ Sbjct: 65 PMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV---PSVYCQTQ 107
>CARP_RHICH (P06026) Rhizopuspepsin precursor (EC 3.4.23.21)| Length = 393 Score = 29.6 bits (65), Expect = 4.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFTR 467 E+ ++IGTP + DTGS +W C C +R Sbjct: 84 EYYGQVTIGTPGKKFNLDFDTGSSDLWIASTLCTNCGSR 122
>CARP5_RHINI (P43232) Rhizopuspepsin-5 precursor (EC 3.4.23.21) (Aspartate| protease) Length = 392 Score = 29.6 bits (65), Expect = 4.0 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + +GTP V DTGS +W C C Sbjct: 84 EYFGQVKVGTPGVTLKLDFDTGSSDLWFASSLCTNC 119
>CATD_HUMAN (P07339) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| light chain; Cathepsin D heavy chain] Length = 412 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 + ++ ++ IGTP + + DTGS +W P + C Sbjct: 76 DAQYYGEIGIGTPPQCFTVVFDTGSSNLWV---PSIHC 110
>CATD_CANFA (Q4LAL9) Cathepsin D precursor (EC 3.4.23.5)| Length = 410 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 + ++ ++ IGTP + + DTGS +W P + C Sbjct: 76 DAQYYGEIGIGTPPQCFTVVFDTGSSNLWV---PSIHC 110
>RENI_CANFA (Q6DYE7) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 403 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVW---TQCKP 446 ++ ++ IGTP + + DTGS +W T+C P Sbjct: 84 QYYGEIGIGTPPQTFKVVFDTGSANLWVPSTRCSP 118
>PEPC_RAT (P04073) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 392 Score = 29.3 bits (64), Expect = 5.2 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +3 Query: 321 LQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 L P+ + + ++SIGTP + + DTGS +W C Sbjct: 65 LYEPMAYMDASYFGEISIGTPPQNFLVLFDTGSSNLWVSSVYC 107
>PEPC_RABIT (Q9GMY2) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 388 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 330 PVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 P+ + + ++SIGTP+ + + DTGS +W P V C Sbjct: 65 PMDYLDAAYFGEISIGTPSQNFLVLFDTGSSNLWV---PSVYC 104
>CATD_RAT (P24268) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| 12 kDa light chain; Cathepsin D 9 kDa light chain; Cathepsin D 34 kDa heavy chain; Cathepsin D 30 kDa heavy chain] Length = 407 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 + ++ ++ IGTP + + DTGS +W P + C Sbjct: 76 DAQYYGEIGIGTPPQCFTVVFDTGSSNLWV---PSIHC 110
>CATE_RAT (P16228) Cathepsin E precursor (EC 3.4.23.34)| Length = 398 Score = 29.3 bits (64), Expect = 5.2 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +SIG+P+ + I DTGS +W P V C Sbjct: 79 EYFGTVSIGSPSQNFTVIFDTGSSNLWV---PSVYC 111
>CATD_PIG (P00795) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| light chain; Cathepsin D heavy chain] Length = 345 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 + ++ ++ IGTP + + DTGS +W P + C Sbjct: 12 DAQYYGEIGIGTPPQCFTVVFDTGSSNLWV---PSIHC 46
>CATD_CHICK (Q05744) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| light chain; Cathepsin D heavy chain] Length = 398 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 + ++ ++ IGTP + + DTGS +W P V C Sbjct: 75 DAQYYGEIGIGTPPQKFTVVFDTGSSNLWV---PSVHC 109
>CARP4_RHINI (Q03700) Rhizopuspepsin-4 precursor (EC 3.4.23.21) (Aspartate| protease) Length = 398 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ ++++GTP + DTGS +W C C Sbjct: 89 EYYGEVTVGTPGIKLKLDFDTGSSDLWFASTLCTNC 124
>PEPC_CAVPO (Q64411) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 394 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 321 LQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 L P+ + + +S+GTP ++ + DTGS +W P V C Sbjct: 68 LYEPMSYMDAAYFGQISLGTPPQSFQVLFDTGSSNLWV---PSVYC 110
>CATD_BOVIN (P80209) Cathepsin D precursor (EC 3.4.23.5)| Length = 390 Score = 28.9 bits (63), Expect = 6.8 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = +3 Query: 279 TGVPVMSSKAVAPALQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 TG P + + L+ + A ++ ++ IGTP + + DTGS +W P + C Sbjct: 37 TGEPAVRQGPIPELLKNYMDA---QYYGEIGIGTPPQCFTVVFDTGSANLWV---PSIHC 90
>POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 117 TGGLTATSSQLGRLEGLRVALTHVDAH 197 T GL LG EG+ LTH+DAH Sbjct: 1544 TPGLPVCQDHLGFWEGVFTGLTHIDAH 1570
>PEPC_SUNMU (P81498) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C-1)| Length = 389 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 330 PVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 P+ + + ++SIGTP + + DTGS +W P V C Sbjct: 65 PMAYMDASYFGEISIGTPPQNFLVLFDTGSSNLWV---PSVYC 104
>PAG2_PIG (Q29079) Pregnancy-associated glycoprotein 2 precursor (EC| 3.4.23.-) (PAG 2) Length = 420 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 354 FLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 ++ ++SIGTP ++ + DTGS +W P + C Sbjct: 76 YVGNISIGTPPQQFSVVFDTGSSDLWV---PSIYC 107
>CARP1_RHINI (P10602) Rhizopuspepsin-1 precursor (EC 3.4.23.21) (Aspartate| protease) Length = 389 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVW---TQCKPCVECFTR 467 E+ ++++GTP + DTGS +W T C C T+ Sbjct: 81 EYYGEVTVGTPGIKLKLDFDTGSSDMWFASTLCSSCSNSHTK 122
>PEPC_MOUSE (Q9D7R7) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 392 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +3 Query: 321 LQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPC 449 L P+ + + ++SIGTP + + DTGS +W C Sbjct: 65 LYEPMAYMDASYYGEISIGTPPQNFLVLFDTGSSNLWVSSVYC 107
>PEPA_RHIFE (Q9GMY7) Pepsin A precursor (EC 3.4.23.1)| Length = 386 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTP + I DTGS +W P V C Sbjct: 73 EYFGTIGIGTPPQEFTVIFDTGSSNLWV---PSVYC 105
>PEPA_CANFA (Q9GMY6) Pepsin A precursor (EC 3.4.23.1)| Length = 386 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTP + I DTGS +W P V C Sbjct: 73 EYFGTIGIGTPPQEFTVIFDTGSSNLWV---PSVYC 105
>PEPC_CALJA (Q9N2D3) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 388 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 330 PVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 P+ + + ++SIGTP + + DTGS +W P V C Sbjct: 65 PMDYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV---PSVYC 104
>ARHG7_RAT (O55043) Rho guanine nucleotide exchange factor 7 (PAK-interacting| exchange factor beta) (Beta-Pix) Length = 646 Score = 28.9 bits (63), Expect = 6.8 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -3 Query: 169 RRPSRRPSWDDVAVRPPVAQLATIAVATKRSNRSCTCAPILFAFDESEKRKLA 11 R+P R+PS ++ AVR A L A K CT A + S +++ A Sbjct: 509 RKPERKPSDEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESA 561
>CARP2_RHINI (P43231) Rhizopuspepsin-2 precursor (EC 3.4.23.21) (Aspartate| protease) Length = 391 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +++GTP V DTGS +W C C Sbjct: 83 EYYGKVTVGTPGVTLKLDFDTGSSDLWFASTLCTNC 118
>PEPA_SUNMU (P81497) Pepsin A precursor (EC 3.4.23.1)| Length = 387 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ + IGTP + I DTGS +W P V C Sbjct: 74 EYFGTIGIGTPPQEFTVIFDTGSSNLWV---PSVYC 106
>CATD_CLUHA (Q9DEX3) Cathepsin D precursor (EC 3.4.23.5)| Length = 396 Score = 28.5 bits (62), Expect = 8.9 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = +3 Query: 312 APALQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 AP + + + ++ ++ +GTP + + DTGS +W P + C Sbjct: 62 APTPETLKNYMDAQYYGEIGLGTPVQMFTVVFDTGSSNLWL---PSIHC 107
>CATD_SHEEP (Q9MZS8) Cathepsin D precursor (EC 3.4.23.5) (Fragment)| Length = 365 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 + ++ ++ IGTP + + DTGS +W P + C Sbjct: 51 DAQYYGEIGIGTPPQCFTVVFDTGSANLWV---PSIHC 85
>PEPA_CHICK (P00793) Pepsin A precursor (EC 3.4.23.1)| Length = 367 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 366 MSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 +SIGTP ++ I DTGS +W P + C Sbjct: 63 ISIGTPQQDFSVIFDTGSSNLWV---PSIYC 90
>MKC7_YEAST (P53379) Aspartic proteinase MKC7 precursor (EC 3.4.23.41) (Yapsin| 2) Length = 596 Score = 28.5 bits (62), Expect = 8.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 345 NGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVECFTR 467 N + +++ IGTP ++DTGS +W C T+ Sbjct: 78 NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCSTK 118
>PEPC_HUMAN (P20142) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 388 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 330 PVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 P+ + + ++SIGTP + + DTGS +W P V C Sbjct: 65 PMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV---PSVYC 104
>PEPC_MACFU (P03955) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| (Fragment) Length = 377 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 330 PVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 P+ + + ++SIGTP + + DTGS +W P V C Sbjct: 54 PMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV---PSVYC 93
>CATE_HUMAN (P14091) Cathepsin E precursor (EC 3.4.23.34)| Length = 401 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +SIG+P + I DTGS +W P V C Sbjct: 77 EYFGTISIGSPPQNFTVIFDTGSSNLWV---PSVYC 109
>CATE_CAVPO (P25796) Cathepsin E precursor (EC 3.4.23.34)| Length = 391 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 351 EFLMDMSIGTPAVAYAAIIDTGSDLVWTQCKPCVEC 458 E+ +SIG+P + I DTGS +W P V C Sbjct: 73 EYFGTISIGSPPQNFTVIFDTGSSNLWV---PSVYC 105
>CARP_CRYPA (P11838) Endothiapepsin precursor (EC 3.4.23.22) (Aspartate| protease) Length = 419 Score = 28.5 bits (62), Expect = 8.9 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 294 MSSKAVAPALQVPVHAGNGEFLMDMSIGTPAVAYAAIIDTGSDLVW 431 ++ ++ A P+ + + ++ + IGTPA DTGS +W Sbjct: 86 LAERSTGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLW 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,483,886 Number of Sequences: 219361 Number of extensions: 500658 Number of successful extensions: 2090 Number of sequences better than 10.0: 90 Number of HSP's better than 10.0 without gapping: 2052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2089 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)