Clone Name | bart29d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CB021_MOUSE (Q8BLN6) Protein C2orf21 homolog | 30 | 4.0 | 2 | ALR_FUSNN (Q8RGA2) Alanine racemase (EC 5.1.1.1) | 30 | 4.0 | 3 | IAA1_WHEAT (P01085) Alpha-amylase inhibitor 0.19 (0.19 AI) (0.19... | 30 | 5.3 |
---|
>CB021_MOUSE (Q8BLN6) Protein C2orf21 homolog| Length = 394 Score = 30.4 bits (67), Expect = 4.0 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -3 Query: 579 LAAEHXHQKATISNTHQLQSCSGCSQDTTQVTHGQSLSRLLFALYQCEATQY 424 L ++ KATIS HQ S G T G S SR + C+ ++Y Sbjct: 276 LQSDSISPKATISGCHQGNSFDGSLSSQTSQERGPSHSRASLVIPPCQRSRY 327
>ALR_FUSNN (Q8RGA2) Alanine racemase (EC 5.1.1.1)| Length = 354 Score = 30.4 bits (67), Expect = 4.0 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +3 Query: 435 LRTDTRRTAVGLDFD--RESLEWCLENNLSKIGADGYSRLLLFDGNVLQ 575 L+ DT T +G + D + +E+C NNL+ +G +S L DGN ++ Sbjct: 119 LKFDTGMTRLGFEVDDAEKVIEYCKNNNLNLVGI--FSHLSDSDGNTIE 165
>IAA1_WHEAT (P01085) Alpha-amylase inhibitor 0.19 (0.19 AI) (0.19 alpha-AI)| Length = 124 Score = 30.0 bits (66), Expect = 5.3 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +2 Query: 281 AFQVPPVPAFRAVAK---RGHQLPAEVLSDVCRR 373 AFQVP +PA R + + G Q+P VL D C++ Sbjct: 11 AFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQ 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,492,553 Number of Sequences: 219361 Number of extensions: 1000500 Number of successful extensions: 3382 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3381 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)