| Clone Name | bart29b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HD_FUGRU (P51112) Huntingtin (Huntington disease protein homolog... | 32 | 1.5 | 2 | DVL2_MOUSE (Q60838) Segment polarity protein dishevelled homolog... | 31 | 3.3 | 3 | AKA12_HUMAN (Q02952) A-kinase anchor protein 12 (A-kinase anchor... | 29 | 9.5 | 4 | GSA_METAC (Q8TT57) Probable glutamate-1-semialdehyde 2,1-aminomu... | 29 | 9.5 |
|---|
>HD_FUGRU (P51112) Huntingtin (Huntington disease protein homolog) (HD| protein) Length = 3148 Score = 32.0 bits (71), Expect = 1.5 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -2 Query: 270 RSSEGLKKSGDGED--GRTSHGGCDGGAAAASTPASRQVVHTERKRAMSASSVRSPETV 100 RSS+ + GD D + GG GGA+A+ TP S R+ S + +PETV Sbjct: 431 RSSQHTIQPGDSVDLSASSEQGGRGGGASASDTPESPNDEEDMLSRSSSCGANITPETV 489
>DVL2_MOUSE (Q60838) Segment polarity protein dishevelled homolog DVL-2| (Dishevelled-2) (DSH homolog 2) Length = 736 Score = 30.8 bits (68), Expect = 3.3 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 70 VVELRTGSPRNRLRRPHGASGHRP 141 VV LR PR R HGA GHRP Sbjct: 156 VVSLRRDRPRRRDSSEHGAGGHRP 179
>AKA12_HUMAN (Q02952) A-kinase anchor protein 12 (A-kinase anchor protein 250| kDa) (AKAP 250) (Myasthenia gravis autoantigen gravin) Length = 1781 Score = 29.3 bits (64), Expect = 9.5 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -2 Query: 267 SSEGLKK-SGDGEDGRTSHGGCDGGAAAASTPASRQVVHTERKRAMSASSVRSPETVT 97 +S GLKK SG + G+ GG + PA E+K SASS PE +T Sbjct: 520 TSTGLKKLSGKKQKGKRG-GGDEESGEHTQVPADSPDSQEEQKGESSASSPEEPEEIT 576
>GSA_METAC (Q8TT57) Probable glutamate-1-semialdehyde 2,1-aminomutase (EC| 5.4.3.8) (GSA) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) Length = 424 Score = 29.3 bits (64), Expect = 9.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 383 DLAASLLHPFTGSVRPLPPLPAFFAE 460 DLAA ++ P G++ P+ PLP + E Sbjct: 200 DLAAVIIEPVLGNIGPILPLPGYLKE 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,222,807 Number of Sequences: 219361 Number of extensions: 1080857 Number of successful extensions: 4036 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4032 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)