Clone Name | bart29a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PI4KA_HUMAN (P42356) Phosphatidylinositol 4-kinase alpha (EC 2.7... | 30 | 5.3 | 2 | SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Sh... | 29 | 7.0 |
---|
>PI4KA_HUMAN (P42356) Phosphatidylinositol 4-kinase alpha (EC 2.7.1.67)| (PI4-kinase alpha) (PtdIns-4-kinase alpha) (PI4K-alpha) Length = 2044 Score = 29.6 bits (65), Expect = 5.3 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 148 NQSPAAPTISPAELVRIKNSIRSAATPPDELAALFLK-GIPHTPFLGDRSIFSLAVSRLT 324 N + T++PAEL ++++I + PP E++AL K + +L S++ L R+ Sbjct: 790 NSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYL--LSVYRLEYMRVL 847 Query: 325 AAARPD 342 + PD Sbjct: 848 RSTDPD 853
>SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Shank3)| (Proline-rich synapse associated protein 2) (ProSAP2) (SPANK-2) Length = 1815 Score = 29.3 bits (64), Expect = 7.0 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 139 STQNQSPAAPTISPAELVRIKNSIRSAATPPDELAALFLKGIPHTPFLG-DRSIFSLAVS 315 +T Q P + I+PAE+ + R P++L KGIP T +G D + SL Sbjct: 812 ATVKQRPTSRRITPAEISSLFE--RQGLPGPEKLPGSLRKGIPRTKSVGEDEKLASLLEG 869 Query: 316 R 318 R Sbjct: 870 R 870 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,359,617 Number of Sequences: 219361 Number of extensions: 342130 Number of successful extensions: 1429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1429 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)