| Clone Name | bart27b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7... | 32 | 1.7 | 2 | APBE_TREPA (O83774) Thiamine biosynthesis lipoprotein apbE precu... | 30 | 4.9 | 3 | TGT_ZYMMO (P28720) Queuine tRNA-ribosyltransferase (EC 2.4.2.29)... | 29 | 8.3 | 4 | MOSA_MAIZE (P15268) Autonomous transposable element EN-1 mosaic ... | 29 | 8.3 |
|---|
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1) (Protein| kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 31.6 bits (70), Expect = 1.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 226 RSLTKEEVEAFWRQRGKPAPDQDGGDHATSPFG 324 +S K+E+EA +R+ GKP P G H P G Sbjct: 1949 QSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTG 1981
>APBE_TREPA (O83774) Thiamine biosynthesis lipoprotein apbE precursor| Length = 362 Score = 30.0 bits (66), Expect = 4.9 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 512 WNCGV*VCALPGLSSCGGSLRKAE 441 W GV VC L G+ SCGG R E Sbjct: 8 WRIGVLVCILCGVGSCGGRARVRE 31
>TGT_ZYMMO (P28720) Queuine tRNA-ribosyltransferase (EC 2.4.2.29)| (tRNA-guanine transglycosylase) (Guanine insertion enzyme) Length = 385 Score = 29.3 bits (64), Expect = 8.3 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +1 Query: 172 GWDSPVLGDDTKARVMRNRSLTKEEVEAFWRQRGKPAPDQDGGDHATSP 318 GWD P+L D +VM SLTK+ E + DG H SP Sbjct: 93 GWDRPILTDSGGYQVMSLSSLTKQSEEGVTFK-----SHLDGSRHMLSP 136
>MOSA_MAIZE (P15268) Autonomous transposable element EN-1 mosaic protein| (Suppressor-mutator system protein) (SPM) Length = 621 Score = 29.3 bits (64), Expect = 8.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 359 PSGLFSIGRPGEPKGEVAWSPPSWSGAG 276 PS F R EPKG AW SW G G Sbjct: 131 PSKPFDQRRVIEPKGTRAWKEVSWDGTG 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,222,728 Number of Sequences: 219361 Number of extensions: 1151925 Number of successful extensions: 3514 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3513 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)