Clone Name | bart26g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HCN4_HUMAN (Q9Y3Q4) Potassium/sodium hyperpolarization-activated... | 32 | 1.4 | 2 | YBX2B_XENLA (P45441) Y-box-binding protein 2-B (Cytoplasmic RNA-... | 29 | 8.9 |
---|
>HCN4_HUMAN (Q9Y3Q4) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 Length = 1203 Score = 31.6 bits (70), Expect = 1.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 200 SGGSDPPPRCCGLRSRPSPAAGI 268 S S PPP CG S P+P+AG+ Sbjct: 877 SSSSSPPPGACGSPSAPTPSAGV 899
>YBX2B_XENLA (P45441) Y-box-binding protein 2-B (Cytoplasmic RNA-binding protein| p54) (mRNP3) Length = 324 Score = 28.9 bits (63), Expect = 8.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 312 ESRGRNGEKRASPYQIPAAGDGRERSPQQRGGGSDPP 202 ++ G +G + SP Q+ G E SPQQR PP Sbjct: 138 DTAGESGGEGVSPEQMSEGEKGEETSPQQRPQRRRPP 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,394,705 Number of Sequences: 219361 Number of extensions: 855777 Number of successful extensions: 2240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2235 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)