| Clone Name | bart25c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOSZ_BRUSU (Q8FX16) Nitrous-oxide reductase precursor (EC 1.7.99... | 30 | 5.9 | 2 | CYB_PARDE (P05418) Cytochrome b | 30 | 5.9 | 3 | YTM1_YEAST (Q12024) Microtubule-associated protein YTM1 | 29 | 7.7 | 4 | ENAH_MOUSE (Q03173) Protein enabled homolog (NPC-derived proline... | 29 | 10.0 |
|---|
>NOSZ_BRUSU (Q8FX16) Nitrous-oxide reductase precursor (EC 1.7.99.6) (N(2)OR)| (N2O reductase) Length = 639 Score = 29.6 bits (65), Expect = 5.9 Identities = 37/147 (25%), Positives = 56/147 (38%), Gaps = 1/147 (0%) Frame = +2 Query: 80 ERMATSMRWIALFLLVDVCALAVSAVIDDGLLPNGDFRNGPDKSQMNG-PVVTGKHAIPN 256 E M++ WI +F L + + + NGDF+ +MNG PV+ G+H Sbjct: 272 EMMSSEQDWIVVFNLKRI----------EEAVANGDFK------EMNGVPVIDGRHG--- 312 Query: 257 WELSGFVEYIESGHTQEDMILPVPVGANAVRLGNDATIRQQL*VSRHTYYSISFIAARSC 436 S + YI ++ I P G + V G + V + I R Sbjct: 313 ---SKYTRYIPVPNSPHG-INTAPDGIHVVANGKLSPTVTVFDVRKFDDLFDDKIKPRDA 368 Query: 437 AQAEKLNVSVDPEFGVLPIQTVYTNTG 517 AE PE G+ P+ T Y + G Sbjct: 369 VVAE-------PELGLGPLHTAYDDKG 388
>CYB_PARDE (P05418) Cytochrome b| Length = 440 Score = 29.6 bits (65), Expect = 5.9 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +2 Query: 116 FLLVDVCALAVSAVIDD---GLLPNGDFRNGPDKSQMNGPVVTGKHAIPNW 259 F++ D+ ALAV V+ G +PN + PD P+VT H +P W Sbjct: 248 FVIKDLFALAVVLVVFFAIVGFMPN--YLGHPDNYIEANPLVTPAHIVPEW 296
>YTM1_YEAST (Q12024) Microtubule-associated protein YTM1| Length = 460 Score = 29.3 bits (64), Expect = 7.7 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +2 Query: 179 NGDFRNGPDKSQMNGPVVTGKH--AIPNWELSGFVEYIESGHTQEDMILPVPVGANAVRL 352 N D+ + D + +++G + + W+LSG V+ SGH+ + V Sbjct: 102 NEDWVSSLDVGDGSKHIISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVKYISNTRLVSA 161 Query: 353 GNDATIR 373 GND T+R Sbjct: 162 GNDRTLR 168
>ENAH_MOUSE (Q03173) Protein enabled homolog (NPC-derived proline-rich protein| 1) (NDPP-1) Length = 802 Score = 28.9 bits (63), Expect = 10.0 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -2 Query: 360 SLPSRTAFAPTGTGRIMSSCVWPDSMYSTNPESSQFGIACFP-VTTGPFI*DLSGPFLKS 184 S PS P+ SC WP S +S P S I+ P TGP + + S Sbjct: 351 SRPSSPVNTPSSQPPAAKSCAWPTSNFSPLPPSPPIMISSPPGKATGPR--PVLPVCVSS 408 Query: 183 PLGNRPSSMTA 151 P+ P S TA Sbjct: 409 PVPQMPPSPTA 419 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,101,447 Number of Sequences: 219361 Number of extensions: 1562812 Number of successful extensions: 4755 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4749 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)