Clone Name | bart24g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HIS8_LISMO (Q8Y5X8) Histidinol-phosphate aminotransferase (EC 2.... | 29 | 7.9 | 2 | SELD2_EUBAC (Q9L473) Selenide, water dikinase 2 (EC 2.7.9.3) (Se... | 29 | 7.9 |
---|
>HIS8_LISMO (Q8Y5X8) Histidinol-phosphate aminotransferase (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase) Length = 360 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 257 LQDASLRQLDVLTANASAAAGVLSTVLQVT--VASRNPNDRVGVYYDRLDVYA 409 ++ A +R++ +LT A G+L+ + + T V NPN+ G Y D D+ A Sbjct: 124 IEGAEVREIPLLTDGAHDLEGMLNAIDEKTTIVWICNPNNPTGNYIDLADIQA 176
>SELD2_EUBAC (Q9L473) Selenide, water dikinase 2 (EC 2.7.9.3) (Selenophosphate| synthetase 2) (Selenium donor protein 2) Length = 367 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/68 (23%), Positives = 31/68 (45%) Frame = +2 Query: 242 HPRFYLQDASLRQLDVLTANASAAAGVLSTVLQVTVASRNPNDRVGVYYDRLDVYASYKY 421 HP L +++ + DVL G+++T ++ + + D V L+ YA+ + Sbjct: 177 HPGRVLSNSAAKVGDVLVLTKPLGTGIINTGIKAGIVGQQTVDEVVKIMTHLNKYAALAF 236 Query: 422 QQITLASA 445 I + SA Sbjct: 237 DDIRVNSA 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.128 0.352 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,718,935 Number of Sequences: 219361 Number of extensions: 422778 Number of successful extensions: 1298 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1298 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)