ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bart24f10 |
|---|---|
| Clone Library Name | barley_pub |
>WIRE_MOUSE (Q6PEV3) WIP-related protein (WASP-interacting protein-related| protein) Length = 440 Score = 25.4 bits (54), Expect(2) = 3.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 207 PQPPPLRRHGRWPRIRG 257 P PPP R HG P RG Sbjct: 341 PPPPPYRMHGSEPPSRG 357 Score = 23.5 bits (49), Expect(2) = 3.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 146 PPPRQRPLAGGSRRPPP 196 PPP + P + G+ PPP Sbjct: 312 PPPAREPPSRGAAPPPP 328
>HRPZ_PSESH (Q9F0B0) Harpin hrpZ (HrpZ-Psph protein) (Harpin-Psph)| Length = 345 Score = 30.0 bits (66), Expect = 4.6 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -3 Query: 399 QPLNSIANRSIFRFLLVKTWDGTSFSALSLPLLKNLKQY 283 Q LN +A +S+ LL K DGT FS +P+LK + ++ Sbjct: 115 QVLNGLA-KSMLNDLLTKQDDGTRFSEDDMPMLKKIAEF 152
>HRPZ_PSESG (Q52481) Harpin hrpZ (HrpZ-Psg protein) (Harpin-Psg)| Length = 345 Score = 30.0 bits (66), Expect = 4.6 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -3 Query: 399 QPLNSIANRSIFRFLLVKTWDGTSFSALSLPLLKNLKQY 283 Q LN +A +S+ LL K DGT FS +P+LK + ++ Sbjct: 115 QVLNGLA-KSMLNDLLTKQDDGTRFSEDDMPMLKKIAEF 152
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 30.0 bits (66), Expect = 4.6 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +1 Query: 367 DGSISNRVQ---RLAKYRFLKKQSELLLNADDLDAMWVCLRENCV 492 DG + VQ RL +FL K +L L AD +W CL N V Sbjct: 721 DGRFPHHVQIAERLEFLKFLLKDGQLWLCADQAKQIWHCLAVNAV 765
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 29.6 bits (65), Expect = 6.0 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 391 QRLAKYRFLKKQSELLLNADDLDAMWVCLRENCV 492 +RL RFL K +L L A +W CL EN V Sbjct: 657 ERLNFLRFLLKDGQLWLCAPQAKQIWKCLAENAV 690
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 29.6 bits (65), Expect = 6.0 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 391 QRLAKYRFLKKQSELLLNADDLDAMWVCLRENCV 492 +RL RFL K +L L A +W CL EN V Sbjct: 649 ERLNFLRFLLKDGQLWLCAPQAKQIWKCLAENAV 682
>TTLL4_MOUSE (Q80UG8) Tubulin--tyrosine ligase-like protein 4| Length = 1193 Score = 29.6 bits (65), Expect = 6.0 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 9/60 (15%) Frame = +1 Query: 352 KKKPEDGSISNRVQRLAKYRFLKKQSELLLNADD---------LDAMWVCLRENCVIDDA 504 K P S+SN+ L Y KK +E NAD+ L A+W L + + DA Sbjct: 788 KYSPSMKSLSNKFMHLTNYSVNKKNTEYQANADETACQGHKWALKALWNYLSQKGINSDA 847
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 29.6 bits (65), Expect = 6.0 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 391 QRLAKYRFLKKQSELLLNADDLDAMWVCLRENCV 492 +RL RFL K +L L A +W CL EN V Sbjct: 656 ERLNFLRFLLKDGQLWLCAPQAKQIWKCLAENAV 689
>BGAL_THEMA (Q56307) Beta-galactosidase (EC 3.2.1.23) (Lactase)| Length = 1084 Score = 29.6 bits (65), Expect = 6.0 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 286 LLEIFKERQRKSAEAGSIPSFYKKKPEDGSISNRV-QRLAKYRFLKKQSEL 435 LLE R++K ++ +P+F+ + P D I NR+ QRLA ++ K+ +L Sbjct: 731 LLEQILHRRKKILKSPVVPNFW-RVPTDNDIGNRMPQRLAIWKRASKERKL 780
>WIRE_HUMAN (Q8TF74) WIP-related protein (WASP-interacting protein-related| protein) (WIP-and CR16-homologous protein) Length = 440 Score = 25.4 bits (54), Expect(2) = 6.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 207 PQPPPLRRHGRWPRIRG 257 P PPP R HG P RG Sbjct: 341 PPPPPYRMHGSEPPSRG 357 Score = 22.7 bits (47), Expect(2) = 6.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 146 PPPRQRPLAGGSRRPPP 196 PPP + P + G+ PPP Sbjct: 312 PPPARDPPSRGAAPPPP 328
>SPD2_ARATH (O48661) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 340 Score = 29.3 bits (64), Expect = 7.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 92 EAGGGRIGACACDCSLLSGWWSDAVPFAP 6 E GGG I +C S++ GW+S+ P P Sbjct: 32 ENGGGEIKEPSCMSSIIPGWFSEISPMWP 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,646,273 Number of Sequences: 219361 Number of extensions: 1185747 Number of successful extensions: 3992 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3985 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
