Clone Name | bart24b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1791_STRMU (Q8DSJ2) UPF0348 protein SMU.1791c | 30 | 6.4 | 2 | NU2M_LOCMI (Q36426) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 30 | 6.4 |
---|
>Y1791_STRMU (Q8DSJ2) UPF0348 protein SMU.1791c| Length = 366 Score = 29.6 bits (65), Expect = 6.4 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = -1 Query: 498 QERNIIYHNREPTCIFSSPVCLHHSLKATVQLSQAISN----DTSPCSTWE 358 Q R YH+ E T ++S L H + +++++ N TSP TWE Sbjct: 174 QRRGADYHSTEKTVAYASATSLRHHRQDPAFVAKSMPNANLFQTSPQVTWE 224
>NU2M_LOCMI (Q36426) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 342 Score = 29.6 bits (65), Expect = 6.4 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = +2 Query: 386 LLIAWLSCTVAFREWWRHTGLEKMQVGSRL**MM----FRSWKLLPMVLQMMSWTSCIIV 553 LLI+ L + + WW + + M + S + M F W LP V+ SW +C+++ Sbjct: 71 LLISILIIQMKYMMWWDNKNIPSMMIMSSMMMKMGAAPFHFW--LPEVMSSTSWINCLML 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,683,782 Number of Sequences: 219361 Number of extensions: 1189823 Number of successful extensions: 3611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3609 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4872342800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)