| Clone Name | bart23h04 |
|---|---|
| Clone Library Name | barley_pub |
>TRPB_STAES (Q8CPB1) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 402 Score = 31.6 bits (70), Expect = 1.6 Identities = 23/64 (35%), Positives = 28/64 (43%) Frame = +2 Query: 290 HMHHNTLGMHKPGVKLHKGSDSFIQNPGGRG*LFHSSKGYIGF*SIVDERSFYAFQSRAY 469 H H +G KPGV LH IQN G+ L HS + + I E S+Y R Sbjct: 269 HNHALAIGKGKPGV-LHGSKMYLIQNDDGQIELAHSISAGLDYPGIGPEHSYYNDIGRVS 327 Query: 470 KTSA 481 SA Sbjct: 328 YVSA 331
>TRPB_STAEQ (Q5HPH0) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 402 Score = 31.6 bits (70), Expect = 1.6 Identities = 23/64 (35%), Positives = 28/64 (43%) Frame = +2 Query: 290 HMHHNTLGMHKPGVKLHKGSDSFIQNPGGRG*LFHSSKGYIGF*SIVDERSFYAFQSRAY 469 H H +G KPGV LH IQN G+ L HS + + I E S+Y R Sbjct: 269 HNHALAIGKGKPGV-LHGSKMYLIQNDDGQIELAHSISAGLDYPGIGPEHSYYNDIGRVS 327 Query: 470 KTSA 481 SA Sbjct: 328 YVSA 331
>NED4L_HUMAN (Q96PU5) E3 ubiquitin-protein ligase NEDD4-like protein (EC| 6.3.2.-) (Nedd4-2) (NEDD4.2) Length = 975 Score = 30.8 bits (68), Expect = 2.8 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +2 Query: 92 PTARPATELRSPDFS---RPTPSAPVAWVHVTAGWVKGWRPRR 211 P + PA RS + PTPS VA+VH T G GW R+ Sbjct: 355 PPSAPAGRARSSTVTGGEEPTPS--VAYVHTTPGLPSGWEERK 395
>PKHG4_HUMAN (Q58EX7) Puratrophin-1 (Pleckstrin homology domain-containing| family G member 4) (Purkinje cell atrophy-associated protein 1) Length = 1191 Score = 30.4 bits (67), Expect = 3.6 Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = -3 Query: 286 GSTAKLLCVSRVTSRSSHQPMHGP*S---TRPPALHPPGCHMHPCYWSTGGGSRKIRAP* 116 GSTA L CVS+V + +H P+ S +L P CH H + I A Sbjct: 653 GSTASL-CVSQVPAAPAHPPLRKAYSFDRNLGQSLSEPACHCH--------HAATIAA-- 701 Query: 115 LCRRP--GGGSL 86 CRRP GGG+L Sbjct: 702 -CRRPEAGGGAL 712
>RSSAB_ARATH (Q8H173) 40S ribosomal protein SA-2 (p40 protein homolog)| Length = 280 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 59 ACFAETGIDQRPTARPATELRSPDFSRPTPSAPVAWVHVTAGWVKGWRPRRSW 217 A + G DQ TA+ + S + +P +AP V V AGW P W Sbjct: 227 ADYGMVGGDQWTTAQISDAAWSGEVEQPISAAPAVGVTVAAGWEAASVPAAGW 279
>NED4L_MOUSE (Q8CFI0) E3 ubiquitin-protein ligase NEDD4-like protein (EC| 6.3.2.-) (Nedd4-2) (NEDD4.2) Length = 1004 Score = 29.6 bits (65), Expect = 6.1 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +2 Query: 92 PTARPATELRSPDFS---RPTPSAPVAWVHVTAGWVKGWRPRR 211 P + P RS + PTPS VA+VH T G GW R+ Sbjct: 384 PPSTPTRRARSSTVTGGEEPTPS--VAYVHTTPGLPSGWEERK 424
>CAH12_MOUSE (Q8CI85) Carbonic anhydrase 12 precursor (EC 4.2.1.1) (Carbonic| anhydrase XII) (Carbonate dehydratase XII) (CA-XII) Length = 354 Score = 29.6 bits (65), Expect = 6.1 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = -1 Query: 372 PGFWIKESLPLC---------SLTPGLCMPSVLWCMCKGPLQ 274 PGF I+E LP SLT C P+VLW + + P+Q Sbjct: 204 PGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQ 245
>MT_PODSI (Q708T3) Metallothionein (MT)| Length = 63 Score = 29.6 bits (65), Expect = 6.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 339 CSLTPGLCMPSVLWCMCKGPLQNFCAC 259 CS P C C+CK PL + C+C Sbjct: 35 CSCCPAGCAKCAKSCVCKEPLSDKCSC 61
>YXIO_BACSU (P42306) Hypothetical protein yxiO| Length = 428 Score = 29.3 bits (64), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 352 FFYPESWWARLTVPFIKRLHR 414 FF +WW T+P IK +H+ Sbjct: 187 FFITAAWWGLFTIPMIKHVHQ 207
>APPC_ECOLI (P26459) Cytochrome bd-II oxidase subunit 1 (EC 1.10.3.-)| (Cytochrome bd-II oxidase subunit I) Length = 514 Score = 29.3 bits (64), Expect = 8.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 149 SAPVAWVHVTAGWVKGWRPRRSWTMHGLVTTPRCHS 256 S P+ W+ + AGW R+ W + ++ T HS Sbjct: 429 SLPLPWIAIEAGWFMTEFGRQPWAIQDILPTYSAHS 464
>MT1_COLLI (P15786) Metallothionein-1 (MT-1) (Metallothionein-I) (MT-I)| Length = 63 Score = 29.3 bits (64), Expect = 8.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 339 CSLTPGLCMPSVLWCMCKGPLQNFCAC 259 CS P C C+CKGP C+C Sbjct: 35 CSCCPAGCAKCAQGCVCKGPPSAKCSC 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,033,989 Number of Sequences: 219361 Number of extensions: 2042245 Number of successful extensions: 4801 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4792 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)