| Clone Name | bart22h12 |
|---|---|
| Clone Library Name | barley_pub |
>PKD1_HUMAN (P98161) Polycystin-1 precursor (Autosomal dominant polycystic kidney| disease protein 1) Length = 4303 Score = 32.3 bits (72), Expect = 0.86 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 304 MNHLIIAHVYSVMRVDPRGPPRVDVIPRLQALLPDPVGEETH 179 M H+++ +V+ GPPR+ + +AL PDP G H Sbjct: 3727 MAHVLLPYVHGNQSSPELGPPRLRQVRLQEALYPDPPGPRVH 3768
>IF2_DESPS (Q6AJY4) Translation initiation factor IF-2| Length = 939 Score = 31.2 bits (69), Expect = 1.9 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -3 Query: 302 ESPYHRPRIFRDARRPTRPSTSRCDPPPSGSPSRS 198 E P R R R+PTRP +R P + SP+RS Sbjct: 240 ELPIQREEPSRPRRKPTRPPVNRSPRPSTPSPNRS 274
>GNDS_HUMAN (Q12967) Ral guanine nucleotide dissociation stimulator (RalGEF)| (RalGDS) Length = 914 Score = 29.6 bits (65), Expect = 5.6 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 13 RSVNPTAIPAPEPEPSPLSVP 75 R+ +P PAPEPEP+P P Sbjct: 281 RAPSPVPAPAPEPEPAPTPAP 301
>AEGP_RAT (Q63191) Apical endosomal glycoprotein precursor| Length = 1216 Score = 29.6 bits (65), Expect = 5.6 Identities = 20/66 (30%), Positives = 28/66 (42%) Frame = +2 Query: 218 KAGDHIYSWRAAWVYAHHGIYVGDDKVIHFTRGRDQEVGTGTVIDFLLVSSGPNRSSTPC 397 ++G H W AWV HH + + F RD GT +D + V GP ++ C Sbjct: 759 RSGTHGNRWHQAWVTLHHQLQPSTKYQLLFEGLRDGYHGT-MGLDDMAVRPGPCWAAKRC 817 Query: 398 LVCSSD 415 SD Sbjct: 818 SFEDSD 823
>MAST2_MOUSE (Q60592) Microtubule-associated serine/threonine-protein kinase 2 (EC| 2.7.11.1) Length = 1734 Score = 29.6 bits (65), Expect = 5.6 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 287 RPRIFRDARRPTR-PSTSRCDPPPSGSPSRSCWR 189 RP+ F +A P + PS SR P S +PS CW+ Sbjct: 1523 RPQAFEEATNPLQVPSLSRSGPT-SPTPSEGCWK 1555
>UN112_DROME (Q9VZI3) Unc-112-related protein (Fermitin-1)| Length = 708 Score = 29.3 bits (64), Expect = 7.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 179 MGLLSNRIGKESLKAGDHIYSWR 247 +G+ +NRI + L GDHI +WR Sbjct: 615 LGVANNRIMRMDLNTGDHIKTWR 637
>ZN592_MOUSE (Q8BHZ4) Zinc finger protein 592 (Zfp-592)| Length = 1262 Score = 28.9 bits (63), Expect = 9.5 Identities = 27/76 (35%), Positives = 31/76 (40%), Gaps = 10/76 (13%) Frame = -1 Query: 391 CAAPIRARTHKKKINDRSCSDLLVPSSSKMNHLIIAHVYSVMRV------DPRGPPRVD- 233 C+ AR HK K CS LLV S + A V S P+ P +D Sbjct: 630 CSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVAAPVNSTAPATPAASSSPKPSPTLDN 689 Query: 232 ---VIPRLQALLPDPV 194 VIP L L PDPV Sbjct: 690 ASSVIPAL-PLYPDPV 704
>HRSL5_HUMAN (Q96KN8) HRAS-like suppressor 5 (H-rev107-like protein 5)| Length = 279 Score = 28.9 bits (63), Expect = 9.5 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 203 GKESLKAGDHIYSWRAAWVYAHHGIYVGDDKVIHFTRGRDQ-EVGTGTVI 349 GK + GD I +R Y H IYV DD V+H ++ EVG+ T I Sbjct: 126 GKPRPRPGDLIEIFRIG--YEHWAIYVEDDCVVHLAPPSEEFEVGSITSI 173
>HEX_ADE07 (P36851) Hexon protein (Late protein 2)| Length = 937 Score = 28.9 bits (63), Expect = 9.5 Identities = 23/87 (26%), Positives = 33/87 (37%), Gaps = 11/87 (12%) Frame = +2 Query: 227 DHIYSWRAAWVYAHHGIYVGDDKVIHFT-----------RGRDQEVGTGTVIDFLLVSSG 373 DH YS++ + A VGD++V+ RG + +GT + L Sbjct: 75 DHTYSYKVRYTLA-----VGDNRVLDMASTFFDIRGVLDRGPSFKPYSGTAYNSLAPKGA 129 Query: 374 PNRSSTPCLVCSSDEVTAATETNGVTS 454 PN S VT T T G+ S Sbjct: 130 PNTSQWIVTAGEERAVTTTTNTFGIAS 156
>TAB1_MOUSE (Q8CF89) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 1 (TGF-beta-activated kinase 1-binding protein 1) (TAK1-binding protein 1) Length = 502 Score = 28.9 bits (63), Expect = 9.5 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 25 PTAIPAPEPEPSPLSVPYCKAQGT 96 PT PAP P+SVPY AQ T Sbjct: 375 PTPTPAPGGRVYPVSVPYSSAQST 398
>SYA_DESPS (Q6AQ16) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 882 Score = 28.9 bits (63), Expect = 9.5 Identities = 32/105 (30%), Positives = 44/105 (41%), Gaps = 7/105 (6%) Frame = +2 Query: 182 GLLSNR-IGKESLKAGDHIYSWRAAW-VYAHHGIYVGDDKVIHFTRGR-----DQEVGTG 340 GLLS + G E L AG+ + AA YA G +GD + + G+ Q GTG Sbjct: 477 GLLSEQGSGVEKLVAGEKGRVFVAATPFYAEAGGQMGDRGSVRWQGGQASVYATQAEGTG 536 Query: 341 TVIDFLLVSSGPNRSSTPCLVCSSDEVTAATETNGVTSSCLSCFL 475 ++ LLV G + DE AT +N + L L Sbjct: 537 LILHDLLVEEGELSLGLEVTLQVDDEERKATASNHSATHLLQAAL 581
>LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1607 Score = 28.9 bits (63), Expect = 9.5 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 359 LVSSGPNRSSTPCLVCSSDEVTAATETNGVTSSCLSCFLSGGALY 493 L S+GP R PC + + A N +T CL C + Y Sbjct: 814 LGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFY 858
>ADD2_VIBPA (Q87GM3) Adenosine deaminase 2 (EC 3.5.4.4) (Adenosine| aminohydrolase 2) Length = 337 Score = 28.9 bits (63), Expect = 9.5 Identities = 23/74 (31%), Positives = 31/74 (41%) Frame = +2 Query: 254 WVYAHHGIYVGDDKVIHFTRGRDQEVGTGTVIDFLLVSSGPNRSSTPCLVCSSDEVTAAT 433 W Y H D VIH D + T IDF V +G +R+ +T Sbjct: 79 WEYLEH---CKADNVIHTEIFFDPQTHTERGIDFDTVLNGISRA-----------LTDGR 124 Query: 434 ETNGVTSSCLSCFL 475 E G+TS ++CFL Sbjct: 125 EKLGITSQIIACFL 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,980,522 Number of Sequences: 219361 Number of extensions: 1407498 Number of successful extensions: 8765 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 5263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8449 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)