| Clone Name | bart22h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4 | 32 | 1.2 | 2 | RB97D_DROME (Q02926) Ribonucleoprotein RB97D | 26 | 2.9 | 3 | DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7) | 29 | 6.2 | 4 | MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemota... | 29 | 8.1 |
|---|
>SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4| Length = 489 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +2 Query: 386 PSLPAGKRKSPGMLSWRRSRSQTPTHAQTPTPSRSR 493 P++PA R S RSRS++P+ + + +PSRSR Sbjct: 447 PNVPAESRSRSKSASKTRSRSKSPSRSASRSPSRSR 482
>RB97D_DROME (Q02926) Ribonucleoprotein RB97D| Length = 471 Score = 25.8 bits (55), Expect(2) = 2.9 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -3 Query: 365 GWSRTSPGPENAPRWWERPWWC 300 GW+ P P A +W W C Sbjct: 308 GWNAPPPPPPGAQQWHANQWGC 329 Score = 23.1 bits (48), Expect(2) = 2.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -1 Query: 454 GLAPRPPPAQHPWALP 407 G P PPP Q+ W P Sbjct: 297 GWGPYPPPQQNGWNAP 312
>DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7)| Length = 1073 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 310 GLSHHRGAFSGPGEVRDHPAFDVVPTELAR 399 G H G SG + D P DVVPTE AR Sbjct: 525 GQPRHLGIHSGGMVICDRPIADVVPTEWAR 554
>MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemotaxis protein)| Length = 657 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -3 Query: 194 TSAAASD*SSWVRRTALGGPWSSEVVSRTR 105 T+AA + ++ VRRTA G +S+VVS TR Sbjct: 386 TAAALDELTATVRRTAAGARQASDVVSTTR 415 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,285,460 Number of Sequences: 219361 Number of extensions: 770084 Number of successful extensions: 3257 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3250 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)