| Clone Name | bart21c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FUMC_BACSU (P07343) Fumarate hydratase class II (EC 4.2.1.2) (Fu... | 35 | 0.21 |
|---|
>FUMC_BACSU (P07343) Fumarate hydratase class II (EC 4.2.1.2) (Fumarase C)| Length = 462 Score = 34.7 bits (78), Expect = 0.21 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Frame = +1 Query: 316 AIGFLRRGSGINRSPE--ETISQN-TEVQGRTSRVNPMKTRLVDNQERPRYLHGSYKYAS 486 AIG G+GIN PE E +S+ T++ G+T +P K + + + Y HG+ K + Sbjct: 224 AIGGTAVGTGINAHPEFGELVSEEITKLTGQTFSSSPNKFHALTSHDEITYAHGALKALA 283 Query: 487 SNVM 498 +++M Sbjct: 284 ADLM 287 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.131 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,722,217 Number of Sequences: 219361 Number of extensions: 1407677 Number of successful extensions: 2748 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2748 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)