Clone Name | bart21b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CEF1_CANAL (Q5APG6) Pre-mRNA-splicing factor CEF1 | 32 | 0.95 | 2 | CPD1_DROME (P22058) Chromosomal protein D1 | 30 | 3.6 |
---|
>CEF1_CANAL (Q5APG6) Pre-mRNA-splicing factor CEF1| Length = 610 Score = 32.3 bits (72), Expect = 0.95 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = -2 Query: 322 PSEWKGKLETERRLSSTTVEAVRTSLRRAAGSGPRDDDD-MSAMAPTRRLKRMNDAAPGL 146 P++W+ R + VE + + AAG P DD++ + P A+ GL Sbjct: 80 PNQWRSISNILNRTAVQCVERYQKLIDEAAGIKPGDDEENLGLSGPGIETLPAVGASSGL 139 Query: 145 SHGDIGHHPSSGAIRSNGDPPPD 77 + G++ +P S R + + PD Sbjct: 140 AVGEMNLNPESKPARPDDEDLPD 162
>CPD1_DROME (P22058) Chromosomal protein D1| Length = 355 Score = 30.4 bits (67), Expect = 3.6 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 22/122 (18%) Frame = -2 Query: 358 DAAGAEHATP*SPSEWK--GKLETERRLSSTTVEAVRT---SLRRAAGSGPR-------- 218 D +GAE A SPS K G+ ++ S + ++V+T + +R AG + Sbjct: 78 DGSGAELANNSSPSPTKGRGRPKSSGGAGSGSGDSVKTPGSAKKRKAGRPKKHQPSDSEN 137 Query: 217 ------DDDDMSAMAPTRRLKRMNDAAPGLSHGDIGH---HPSSGAIRSNGDPPPDLLAL 65 DDD S++ R + R + + L+ G P A+ SNGD P + Sbjct: 138 EDDQDEDDDGNSSIEERRPVGRPSAGSVNLNISRTGRGLGRPKKRAVESNGDGEPQVPKK 197 Query: 64 RG 59 RG Sbjct: 198 RG 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,997,676 Number of Sequences: 219361 Number of extensions: 860307 Number of successful extensions: 3433 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3432 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)