Clone Name | bart20g04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SCAM2_MOUSE (Q9ERN0) Secretory carrier-associated membrane prote... | 33 | 0.48 | 2 | SCAM2_HUMAN (O15127) Secretory carrier-associated membrane prote... | 33 | 0.48 | 3 | Y851_TREPA (O83823) Hypothetical protein TP0851 | 30 | 6.9 | 4 | WDR71_CHICK (Q5ZK69) WD-repeat protein 71 | 29 | 9.0 |
---|
>SCAM2_MOUSE (Q9ERN0) Secretory carrier-associated membrane protein 2 (Secretory| carrier membrane protein 2) Length = 329 Score = 33.5 bits (75), Expect = 0.48 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 14/59 (23%) Frame = +2 Query: 452 IEEKNWPPF------MPLIHHDIANEIPTHLQR---MQYF-----AFASFLGLVCCLFW 586 + + NWPP P + D + EIP QR M Y+ + FL L+ CL W Sbjct: 115 VRDNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAW 173
>SCAM2_HUMAN (O15127) Secretory carrier-associated membrane protein 2 (Secretory| carrier membrane protein 2) Length = 329 Score = 33.5 bits (75), Expect = 0.48 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 14/59 (23%) Frame = +2 Query: 452 IEEKNWPPF------MPLIHHDIANEIPTHLQR---MQYF-----AFASFLGLVCCLFW 586 + + NWPP P + D + EIP QR M Y+ + FL L+ CL W Sbjct: 115 VRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAW 173
>Y851_TREPA (O83823) Hypothetical protein TP0851| Length = 724 Score = 29.6 bits (65), Expect = 6.9 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -1 Query: 547 CEVLHSLKMSRYLIGNVVVDEWHKRRPVFLLDDN-TSSCCRFLSSFQF 407 C V + +K R+++GN ++ R +L DN T SCC L++ F Sbjct: 286 CRVFYGVKAVRFVLGNNCALKYGTRLIHSVLGDNSTISCCEVLNALIF 333
>WDR71_CHICK (Q5ZK69) WD-repeat protein 71| Length = 392 Score = 29.3 bits (64), Expect = 9.0 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 475 RRPVFLLDDNTS-SCCRFLSSFQFL 404 R+PVFL D + + +CC FLSS FL Sbjct: 271 RQPVFLFDGSDAFNCCTFLSSTYFL 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,067,797 Number of Sequences: 219361 Number of extensions: 1509785 Number of successful extensions: 4336 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4335 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)